SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000474100.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000474100.1
Domain Number 1 Region: 31-107
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000101
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000474100.1
Sequence length 154
Sequence
MSVLLTGIKPQLKDTKYLHTNHSYSITRRRMLDPNIAREILKLLDFDGSGTVKTSDLHEA
FMGTGLSEADVNEFIRKYDKGNKGKINLEELTAMLDSVHRKTNIFLLRPFCYKPQSKHCP
SFVNKFSEAWLFIFDLTLLVTGLTSSNFRLNMLL
Download sequence
Identical sequences A0A068Y322
EmuJ_000474100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]