SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000496800.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000496800.1
Domain Number 1 Region: 86-321
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.4e-67
Family Calponin-homology domain, CH-domain 0.0000705
Further Details:      
 
Weak hits

Sequence:  EmuJ_000496800.1
Domain Number - Region: 1019-1158
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000112
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 2944-3039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0216
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000496800.1
Sequence length 3597
Sequence
MHPSTIHLPCDFTSNCLTSPSLETRRIARQQISESACERYTRVIDQLSAQQSDRQGSQSL
HSRHHSPPSRLLSSSSRTHIDPNPKLSRLEHCQTTLESMEGMTPEQKISTKRGEQEYVQK
KTFTNWMNTYLIKANPPIKVNDLFEEIRDGVVLIRLLEILSRETLIRLVNINPVDIVDGR
PKIVLGLIWIIILYFQIEEQEEMLLELLGIPKTGNRSKITAKQALTTWVQNAFSEKFNID
IKDFGPSWRDGVAFNAIVHSIDPRLVDMQEVERGSNRENLHRAFTVAEEKLGIPKILDPE
DVDVEKPDEKSIMTYVAQFYKAYPETGKAKTLTSDEQEQRQFTEFLDTLQEAESRITESI
QMNEDFKMAYSVYITTVELIEKYSKFVDLLQQKADDCILVGGQYSPHSGLDAFNHFEERL
KEWRWWLLERLPGDLQQSGRWMVLVEQWVEQVDVGWSQDEEDGIPLPGNEKTIHKLMEEQ
TKIFGPEVDNAVTEATRLKKFLAKSDLDESIVEKLEETMAEVMNKVDGYVVVLGASGCYR
SVLNAMQEANLGELIGEWAELISGNRQNETLALVISAHEAFMPWEEKFALSGANPSPVND
LTNRLNSVMQLEQSARPLPRGATSEVIGYWLQRTADAFHPASLDDISLRELGQRLEERIQ
AWKTYETKLNEAVAQMEEVYRQLKSDHVGSKKANLEVIEEMLQEAETAAGALGTQTQLSS
VAISLRQFEELKVMIEEKAREEELLREAVEKRVQKVLTSISNWNGRAEAILTDPEQMPSK
LDMKITAIQELMAETDSLDDLLQSIEQTKSGTLADAQVEEMDAVAMEFFQQQRTLSAQMK
NLEQILTKSDEIENLLTQMEGEIQAPSKNFEELEATFNKGLPELTTLISDLENLIRSAPV
KTYVQDLTFDESKERKAKLADAWKTLKTSHRMKVQGKQDLEEAFNVVDALIIEMARYFDA
IESDLASVNVDLVKRGMAMFQDLEQTLDERLPKDMDHLRDIREAIHKLIPGHLERVQLIG
KLENKVTDVEQRYEDLLERKAEIEKESRKALARLQGFKKFAEVLQNVVGNAKTKLLALEN
GPKVSGKSAQKDLEAINSWYSDCSDLTNMINACQNESIGLQSLLDDPDFNAPSGCVEIQQ
EHVELCDKINDLFTRANAFKTAFNLFKDHEKTVELSLQEIKSFTSKPLGGSRHSLIASST
IDLSRRAEEIENQLQVKARTTEVLQEMQTCVDRISTTRLSTDNVRLFQGELDELKKRVEL
AFTALLSEHGEVTRSLKAHSEVEDNLQILEEWLTKMEDQVRLSSMEASTAQVNLQILKSE
FTRLTSLFKEISSTGSQRVSSLLAKREEVSDETTRERKRRLKTQYDALMKLASQERDRCS
KVLTAWNELNSRIHTCNALLHGVEGKLGGVADDNVNKEVDSLKDALQNASRRGLQNQRIL
EEVGSSLGDVDKAIHEIQQYQQRNLPLGLILTEVEDLLERRMQAKRRHEELSSDLQGKRT
IWTKLQDAHKTFSQLVEQANSDLLACRPSYPANLHPRQLKQISEAVESIRQKEAVCAKSV
EEITNAISAHVDSKVAEMRHLCDELGEGIVSLLEMETGKVQKIKLDLDEAFLAQANISRK
AEALCSSFTRVRNVLETTNSKMDELLKFKTSRSPEDVLKGLKGLADCLDQEERDALSDFT
TDVEELQKAFHVPRQVPQFLCKLPDSLQECFSETSKRLAKVSSDASAKVTELEDLYFCLQ
IAVSDLETDVDKIVGLLEECEEVSSPTELPTLQAKLKECEGSYNSSVNKLKRVMPQASKV
KSSDKLTDLLAEASRLLTEGQTKHDAVKTRLKQQNVQFDQFTKSVSAACEAVNANISSLQ
QNVHFRLPIQDIQELKERLKSIEVLEEDLEAAEGSTPVEVSVLNTITILPGIESKVNHLL
QHTSTFSDIFVDDALRPLQTALKTYSGCLDKARESLEGVIEAASAWMANSKEQMEELRTV
SEDLKILDYCPSVDFDSSPTARMEGLQKARDMERSWLPQKLRQVEKLIREASDNIAAGID
LANIGEIHARLEELQKSATTVKTNVSKATLLWETRVSEERELKQLSAMADALCERFRKDL
DDIEPRYRFVSALEEEEMLSRLHFLKGQVPVGDELLAKIRSIASSDNSTLPTLSFLSMWE
NLVKHRLNSLIEGVEKAISEKTGKEKEILMLQAWLDEFQHVVQQATIDAQSSNNITALND
HLKQLKSQMSQWENLHFGPYSLKPGAKEKLTVLEGQRGSIQKQLDQLERVIQEKGDIQKV
VEYRLKQVMMEVEGLCAELESRFFNTSQIQEATSAEEVCTNLRGSRESLKSLYEPKIENV
LVKVYSLECDAASYPSLLGSLQDCRQKVEGARKTLQIVDGNLSSQINAWEDVLSTAKKID
KWIYENETEGLTEKKDNTEVIAFPVEAFSKMESQRNTNRLRSIAEQRCLEVCSAKNRLDA
SATGKDQLSQLHRKANRITEDKVVLKFMLDNYEAKVNEKVDELKFKLQVAEEGLNRVKKL
QVAVNNLDALVLECNEATLTMEELNRLSESAQTLLESEIKPHVQDDLELRVQLARGQRLL
QIIQTWQRERQAQDRLVASERESLKVLTSNLRGWLQHWNRSLEEARNTADLELGIQLTAS
IPCNKFRCLDNVRALHQDVQTKKREIEEVTERRRTMSLMENEAEDAELTSLRRGIAAGER
KASRCVSELTEMCTHIERLRGSLAKTKEWIKSVKKRLGRLKALRSRHDPIDIGEDGLSTE
EIEAIASKLRQNQIHTLGLLQASINASEGSSGSASLLQVALTEVDKMDQEIDQMLTAISQ
AKASYANYCALVAGLERSIQNSSEALTTTSARVNDLLTTYLGSGGRLPVLSVKISSSRLA
PQVERMRVELANLDDLGWVDGVDMLVQELKFVEADIKMNAAQFQSMVDQCGVLRRDHGDD
SRTAQVNQLFQQNNQLLRACEELIDHFSTVAAQSAKWNVTCQDFVGWIDKQAFILSRLNN
SPTNTVPTEQCLTELKKVQAELDSSVAKQQAVADETQKLTITLSRAMHSLDATTALIPAS
STRVYPRHSFRLSASYRWHDSVMSAVGVLDDLVKTIPNKIAEYEKLLVKWKEVMDGRTGL
VKWLDTAEAKVNESVQLIENQEATESATVWNHQLHEMRALDSTVSEKRIEIKKVEEEIFR
FSSQTSGLAMTDTANRLNAFEKRLRNHLNFLNDIQELADDFRRVSHDLMSWLQRRESRTP
QPDAEEGALKLEQCRSIVQQMVIRVNSQSHQRHFPRKLGDTSKLLQELSGWKSTASVLIC
DVIRQFQKLEEQFGKATSSGDGSAQCSTMDWPYFCRIVRQIQIYLDENLPGIHSLLPTHG
YDDTVSKLAFATSTLARLEDFSGQISVTMKLLSNDDSGGSPQQRSDRIGRIVTKYDSSML
IVVRETIMRLETAMSKLKEYIENLRRLQEDWRIYVADLDSFRSWLFQRTLFSKRDRQRSS
FEEIKQEGERLRGLRDTFRRLSGNRLQVDPELEKLNNDYRNLLYRMRHREPPSPSSHGSA
EPESLRYSRSGVLADLLQTVQHIKSDVEQADLRAERSYHNLHRAFHRTMRRSRSQHH
Download sequence
Identical sequences A0A068XZN6
EmuJ_000496800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]