SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000526200.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000526200.1
Domain Number 1 Region: 292-590
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-83
Family Protein kinases, catalytic subunit 0.0000000194
Further Details:      
 
Domain Number 2 Region: 167-263,298-325
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-35
Family SH2 domain 0.0000387
Further Details:      
 
Domain Number 3 Region: 61-137
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000126
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000526200.1
Sequence length 1186
Sequence
MGGSIGKPASSKEGSEKVDLSLSFNQQPDEISTGGECEKSAPVKKQILSVTQNFETSGLV
EQCIMIVLYDFSATLDSQLTVKRGEIVRLLSYSPAGDWSEVEAPSHLPNRTPRVPWAGAG
GWVRGWVPTSYLTEHVRPPRVGGIGSGTNGWRRVGDEEEAGAAAATMAYPWYHGAVSRQA
AEQLLRSGITGSYLVRESESAPGQLSVTVRNLGRVYHYRISRDSCGWYFITETHRFPTVV
QLIHHHSQAADGLICPLLYPAARREQPSVMRGAATNSGAVEGCADSKGGGGYVGFDDWEI
DRSEIMMRNKLGWGQYGDVYEALWKRYNSIVAVKTLKQDVDLNLNDFLAEASIMKNLQHK
NLVRFLGVCTREPPYYIVAEYMPHGNLLNYLRQRSPGELTPPILLYMAVQIASGMAYLEA
NNFIHRDLAARNCLVGDQYTIKVADFGLARYMQLHEDTYTARNGAKFPIKWTAPEGLAYF
RFSSKSDVWAFGVVLWELATYGLSPYPGVELHGVYQLLEKGYRMQRPHGCPESVYSIMLR
CWSWEAADRPTFLSIKAELEEMWRTIDMTEAVAQELATPPAAQTTDHMQFITATSTTATT
TITTAVGVGPGINGGGEAMLSSVPVSMIVRMPSYQQDDDEAAEDPSSPSQSTTSCTSSSS
AAVSSSSAAETDGQDGDDEGEEDLCLKSLVDKGALSSTANWITTRTSDSLYQGDYIVSGG
GGGGGGVVRATPASDLPFATHKSTTCDSQVSAPASLPPLHHLQQFQHHRNRANNHSHHYH
RHYQHQLQHSETGRSMPRRRSGPNHLAGQFEEGSLRCPMRPKEKNITPAESGVGESIVSA
DSPGGNSNAMQQEEGAVVMAPQRSNHKAAAVVAVAVEANNCCVTPTRDMISEVAPDERRM
RLDVESVTQFTTLPAQDRITRYLESLGELGDASEERTPKAKGGAHPPHPPLLSHFPPPPP
VPPPPQPAQHLRNSRMLPTEHRRNAVGRSASCYQTVSSVQLLLPPSTTTTNGSVETQESL
PTTSTPSPAVGETITPTDDVYQAPTLAQDSSIGGNGGVKAAPTAEVSSEVEQAELTACLN
TLSLEATELSTACPQLAAELSALSLQLSACRGKVEARLRASANGVGGTAEENLCLAGVAQ
ALRHIQQALAEMRARVEEAQTPTPSLPAPSATAPAATNANATTVST
Download sequence
Identical sequences I4ENX0
EmuJ_000526200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]