SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000584900.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000584900.1
Domain Number 1 Region: 42-117
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000617
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000584900.1
Sequence length 718
Sequence
MENSPSFTSSTSTTSAANNSSNTTGTSAVTAGTNSSIGPNTTVLARALFDNSAEVAQELT
FSRGDVLIVLKRDPPGFEGWWICSLAGRVGIAPGNRLEILGSVKPKIRTVEGRTTTSPNT
STTTTVTAQVNSPEVDPYDELPAVIEVAPPIPSHPSGMDQSIYANFYENYPPGGALDSRN
GSPSFRNPTALSRYMSSKPEEGPIKSVSFAAPKSTATTNTEATNSHLTAECNSKDHQDTH
SSESIPKRSVKRSGLSSVAQASKHSVRFVDPAPPEADANNRCLDSTCMNIVAEEKLPSDP
PQRLTVCSGQHEEARLSPEPTDPPSSTVNMENGPLSNLLTVPPTFRLTRTTSAPLSARFS
RPATSFSSWQQTHSRIELLINEALASMERFEKGESTQTLIQKMCNFKQGLSAELSHLEQL
CDTFNSDDLVLNDFLQQERQKIARLRDGRLLQDFQRLKEPSPEEGFNALASSLEQISLST
QAIIDTVQLNRFDCADIEHSRRGQHMEDNFGSLSVSDREDSATTSLDSNDPTDLSGLLHV
YAAQFHSHTLLVRGTAEEFLGCLQCKVNEPRTVRGYRLPTAGVLIANAKFLLRCSSQLVS
LAANLSAALQSLPPSEVSNSAPDIEKLRSGLEASGNAVCEALKGLIAQTKDVAGCLTSPS
LDLPTTATTLASKPVVVLGPEMERLVGAVQDVVATTEGLRQTVANSSALRNSVSSVER
Download sequence
Identical sequences A0A068Y832
EmuJ_000584900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]