SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000587600.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000587600.1
Domain Number 1 Region: 177-241
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-23
Family SH3-domain 0.00056
Further Details:      
 
Domain Number 2 Region: 36-153
Classification Level Classification E-value
Superfamily SH2 domain 6.36e-22
Family SH2 domain 0.00011
Further Details:      
 
Weak hits

Sequence:  EmuJ_000587600.1
Domain Number - Region: 4-40
Classification Level Classification E-value
Superfamily SH3-domain 0.000167
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000587600.1
Sequence length 247
Sequence
MEADAKHDFQASAADELPFCKNSVLKILSVEDDPNWYLAEQDGRKGLVPCNYISFRPNPW
YMQACRRNTAEECLLETDPYTGLPVQPDGAFVVRRSESNGPGFSLSVKDGQKVQHFKVLQ
DEMGKYFVWLRKFDSINQLIDYHRRTSISRDGFLLLVDRQPSRMISMGRGDQQSQMVQRV
IARFDFNASEPEELSFHRGDVIEVLGQEDENWWRGRISNTGSTGLFPANYVDTLPPIMPN
AAHRPTN
Download sequence
Identical sequences A0A068Y1U5
EmuJ_000587600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]