SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000598200.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000598200.1
Domain Number 1 Region: 329-611
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.65e-81
Family Protein kinases, catalytic subunit 0.000000071
Further Details:      
 
Domain Number 2 Region: 214-363
Classification Level Classification E-value
Superfamily SH2 domain 8.11e-36
Family SH2 domain 0.0000952
Further Details:      
 
Domain Number 3 Region: 155-239
Classification Level Classification E-value
Superfamily SH3-domain 1.34e-20
Family SH3-domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000598200.1
Sequence length 645
Sequence
MGNRSSIKSSTDMIVPRSFALPRRPKMGSGIPQLPNSRWKPPRSKQKDCVPYGSKSEISP
HKVAYGSSTYMARQNRMHTVPYTANPLSHPANTTAQTVTQTTMAMAAVGGCQTTPASRPI
SLPRPPDASSVGAVAAAPPVASRHSIGDTYHRWSQKYVALHDYTARVEDDLSILKGQHFY
VMDRSQGYWWYAKCAATGKMGYVPFNYLAPIASLESNEWHFGDMRRLEAENCLMMPGNDH
GSFLVRISESRSGEYSLSVRDGDVVKHYRIRSRPSRTNPEVRRYFISRQLPFSSIQQLVE
HYMKNQSGLCCELIAPCIKPVHPVPVGLSHNTVDKWEIPKSSVVLKERIGKGQFGEVYKA
VWNGTTLVAVKTLRANLCNAEDFLMEAQTMKRLHHPHLIQLYAVCTQSAPFYLITELMSK
GSLLAFLQSAEGRALGVAGLALLAVQVASGMAYLESQRYVHRDLAARNCLVGEGNVVKIG
DFGLARMIHNQEYVAHAGARFPIKWTAPEAANYSRFTTASDIWSFGILLTEIVTYGRVPY
PGMHNAEVLRQVEAGYRMPAPPGCPAELYDLMLECWAADETARPSFASIHGRLQVFCEEW
DRPAYRDPATATSGTAVGVGTTSERCDSPPPPLPLYRRHVTARQN
Download sequence
Identical sequences A0A068Y8B8
EmuJ_000598200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]