SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000751400.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000751400.1
Domain Number 1 Region: 216-279
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-18
Family SH3-domain 0.0003
Further Details:      
 
Domain Number 2 Region: 5-32
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000769
Family LASP-1 0.02
Further Details:      
 
Weak hits

Sequence:  EmuJ_000751400.1
Domain Number - Region: 32-60
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000228
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000751400.1
Sequence length 280
Sequence
MHMERSCGACGKTVYPTEELRCLDKLWHKSCFRCQECRKILGIHNFKGHGGKPYCNVHYP
LSKSFTQVSDTPEMQQVAINTKNMSKIQYHRDYELSRGRQASLPESQASFDYGNEFSRTV
ETPPMQQQSYSRSSTGEQVKKVPLSPESYSFSQPPMNVTNGNARDNYAKTNTQTASVLKN
DNVGKSKESVEEEGDAVPIYRPDLVMIGGMKVTGSGLHFQAVYSYEAAEDDEVSFVEGDE
ILHGEPIDEGWMFGTVRRTGQFGMLPSNYVVPIQNPNYNP
Download sequence
Identical sequences A0A068YCP0
EmuJ_000751400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]