SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000826200.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000826200.1
Domain Number 1 Region: 7-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.02e-72
Family Protein kinases, catalytic subunit 0.00000735
Further Details:      
 
Domain Number 2 Region: 735-927
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.51e-52
Family Nucleotide and nucleoside kinases 0.00000109
Further Details:      
 
Domain Number 3 Region: 581-696
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-30
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 506-597
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-19
Family PDZ domain 0.0000711
Further Details:      
 
Domain Number 5 Region: 354-408
Classification Level Classification E-value
Superfamily L27 domain 0.0000000765
Family L27 domain 0.0015
Further Details:      
 
Domain Number 6 Region: 419-472
Classification Level Classification E-value
Superfamily L27 domain 0.000000141
Family L27 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000826200.1
Sequence length 931
Sequence
MGDEDVLFDDVYQLCEIIGKGPFSVVRRCVHHESGQSYAVKIVDITKFTGSPGLSTADLK
REASICHLLKHPHIVELVETYSSDGMLYMVFEYMEGADLCHEIVKRATAGFIYSEAVASH
YMRQVLEAVKYCHENNVVHRDLKPHCVVLANKQNSAPAKIGGFGIADQLNPDIGCFPDGA
PFTVDQEIFVSLRSDQCGRIGTPHYMSPEMVRHEPYGKPVDAWSCGVLLSVLLGGSLPFY
GTRETLYSQILDGQYRMNSNAWNAISSEAKDLTMRLLDVDPNHRMTIEEALRHPWIAQKS
RAPKTHLHATVEAMKHFNARRRLKNAILAAVSSTKWASFYSVDSGSRASEAVDDDEVTSA
AVSLILDSLEEMQCLTETGPEAVGWKELSFQDQQLCDLLELYDLINSNPLSPNVTLPDNA
TAKAQDVIEELTATVSEDFVHDADELRYILTLPHFRALLRARDVIAHDVYGEAAIRVTPP
PTTIFGTSTTNGEEGGNDDIEEPPDPGRHVTRVRLVQFQKTTDEPMGITVKLNEEDKCIV
ARIMHGGMIHRQGTLHVGDELREINSEPVHGKSVEYLQRRLREARGSVTLKIVPSYRTNP
IQCEIYVRAMFDYNPEADELIPCAQAGIHFHVGDILQIISKDDHNWWQARLWGSDPQSPA
GLIPSPEFQEWRVASRAAECSHGHGDQQVVNCGSWFTRRKRGNHGSGRSASERARYSAIY
DQLDLYTYEEVVRLPTFRRRTLVLLGAHGVGRRHIKNCLIQSAPDKYAYPIPHTTRAPRK
DEVYGKNYYFVTQEEMMRDITNNEYLEYGTHEQAMYGTKLDTIRQIHAAGLIAILDVEPQ
ALKVLRTAEFAPCVIFIAAPDLNTIFSDLNCPNDGSLERLARESQLLEQHFEHFFDMKIV
NNDMEETIKKLQTGIEGLQTRPQWIPVTWVY
Download sequence
Identical sequences A0A068Y816
EmuJ_000826200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]