SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000900100.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EmuJ_000900100.1
Domain Number - Region: 130-241
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00222
Family Myosin rod fragments 0.012
Further Details:      
 
Domain Number - Region: 392-584
Classification Level Classification E-value
Superfamily Tropomyosin 0.0101
Family Tropomyosin 0.0065
Further Details:      
 
Domain Number - Region: 647-841
Classification Level Classification E-value
Superfamily Tropomyosin 0.0157
Family Tropomyosin 0.02
Further Details:      
 
Domain Number - Region: 53-155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0489
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000900100.1
Sequence length 866
Sequence
MAEEQEVVEVNYEEQYRILSEENKKLSIDIASLQLSNRSLVNQNRDEKKKVMDCRLQISD
LESRLRTLDSIKTELTESQTQAERLRQSLDANETKLAATERRATEAESLVKVKDSIIEKQ
RKFSKELEGKVQNLSEEVEGLKSKCGKLEVTLSEALDRADECDRLRENVAAKTALLDKIA
ESSGGVSESGLAAANKYFKEQEAKFVEQLAEMKQAKSELERNVKDLTDERDSLQEKIENQ
DADIESLREKCANLEASVKESKHSDKRTKGDMANNRLIGPSLPPWILEEKKPDPSEIEKL
NNADPATLRARVLDLEGKVHELNQLLTYREDVILRIYQEIQKKASRLEAAEVERSSLSAQ
VSILKRELATLREDGGLRGGGRRYDGYPPEIEIEIERLRGKRDREYQRRKRAEAEMDEME
VELNEVKEKMKKVEEELAEIANAPKPVIHSGDPADKARITELQTAVNQLRLDNEAKRSEL
FDLRSRFDEKSAQLESFSSEMKTRERQVNDLTAELTTKTTQLEQVNKELEAVRLRVVRGG
VETERWQTDLNSVRTTNRFLAQQTNELRLRLTTTEAQLIDAQKRIVSLLKSKSDAPLCNG
VTEDDELLAKDKEIADLKSKVTDIESQLTKAKENVADLEASRSEINELRAKCAALTVELE
SEKHRVNSETIQNSDDTHRITQLLSDLKKEHQSSTACAERCTELTKQLTELESTLAETRE
RLNEATSENRRADLEQAAAQAVGASSPPAKRVRRTRSSNANVPAAVSQECAACAELKRHL
QALESDLSDANTKIGNSVTELNDLRARLSEAGEEACRLRQEVSSLHEDLAANASGLKKLR
HVARAYLEDKSSSVLAEQLRQLLAVE
Download sequence
Identical sequences A0A068Y987
EmuJ_000900100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]