SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000903800.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000903800.1
Domain Number 1 Region: 11-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.55e-68
Family BAR domain 0.00000175
Further Details:      
 
Domain Number 2 Region: 297-374
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-23
Family SH3-domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000903800.1
Sequence length 422
Sequence
MSFTGLRKQINKANQFMSEKIGGAEGTKLDEEYIHCEKQIDAMSKLIEEIITKTHEYLQP
NPATRAKLATLNTFNKIQGKGKAPPYPQPEGQLGDCMLKYGNELDHDSLFGECLIQTGYA
FKNMEDIKYNMEDQVKREYIEPLRGIQSVELKEINFHRKKLEGRRLDFDCKKRKKESNIL
KNPQAAKVLEAEIKVAEEKFQESKVLAETAMANFLASDFEHISALAEFVDAQANYYRHAS
EIMENLHKVLLEKKDEAQSRGKQIHNPKPLQITRTLSGEVSTKNGSMSSPRTPNKSPAST
GGSGPCCRALYQFEAENDTELAFSEGDIIQLIRQVDENWFEGRLRDKEGFFPVNYVENLR
CPLFPPPPRLHNKSPDALSHPLTLTPRGSGNQIKGQYIDAIILHLIYLSRFIRPPVFPTP
HS
Download sequence
Identical sequences A0A068YDL5
EmuJ_000903800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]