SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000910400.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000910400.1
Domain Number 1 Region: 62-190,221-330
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-64
Family Calponin-homology domain, CH-domain 0.0000461
Further Details:      
 
Domain Number 2 Region: 819-935
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000719
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 3 Region: 7177-7305
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000144
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  EmuJ_000910400.1
Domain Number - Region: 5960-6071
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000201
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 1754-1876
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 5840-5951
Classification Level Classification E-value
Superfamily Spectrin repeat 0.054
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000910400.1
Sequence length 7603
Sequence
MYDLGTDSEMFKGISSAQHQNILQNRLHQLRRPRIFPEDVSRSAMEERGMSCSTQAYGSA
GYFAVQRYRKEQERIQKKTFTNWINTYLAKAIPPDYVRDLFVDIRDGVKLVRLLEVLAGV
RLPIERPTAMQRAHYLSNVRTALDFLTGKRKIKLVNINPSDVVDGRPAIVLGLIWSIILS
FNIDERNEALNVATGVAEVTKKDQTVSATPSPRTIAQGKTPPVAPVARKKALLAWICRCV
SPSLRSLGLQIRDFGPSWRDGRAFCALVHSVEAESLDLSKIRPKDNKANLKLAFNAAEQC
LGIPQLLDVEDVDVDNPDERSVMTYVAQFLKEYPNGKKTTKLVNQKLGGRSGGGVASAKS
FETPLDAVDSAIDPSLVLSASTVSLHNPKSTQKERVTTPTLLDDEGIRSLLAATSSSLTA
SDEEVVTNPDAAHSMPNIRAMSLTSPRRQARARTYADLRLARVAKTFSRCRAIANIRVTA
DRTEETKNAVKIIHIENQIKDSNVQAEEERNFVIHIKGLISRIRHEPLEPKDLLQELEEF
YQAEQQHQSLTTCLVEMGKRKRQGVLLGILPSELAEIEAKWTQVKPALDEWRWRLDDSLP
GDWATVGRWLGQLERCLSTAARLAIELDAASTDATTQCSQFAARLHDLEEKLKDKDRMSE
LLGLLVKTNTANEPSALPITVVNAIKKRFQDVCHEAQASLRRTNRLYLRWKLADNITEIV
DYINVLKNTRYQKVEEAAESMEQIQEWKKSKGLPQRMDEDIAALEELCKESEDKSNSDSA
TSVGEQPGSGLLTIQIKAGGGTLIMRDVAETERIEASMYLSSLRVRWAEALEDLLALEES
SMKLVETWRAYETEAQTLHAWMQEAESKLKGKTISNTENRFILAQAKQWRQRLNALQDLG
AKLIGQSTIPAGEAINTQLVSMLHRLDSISNEVEKSYQAATVETLKRDLDQTLNRMNKML
QAATDLLNKEVCLPQTTSMQKAEEATSEYRNQLQTTKEDLLNHLETEYNMAKELAEKLMA
AAQEGEIDYSEAERCMQETDRLRRLLQQMAEEKIDNRLSELALAMREAVSVAVRLAQMSE
WIEETETVTNANSFTTLDEIMPDSLASIAPDEAIHRLQKCCDSIITHTKALEEAEGRLEE
LKAKGLKSVNISQLETAIAETKGRINIMLEQTRKREQLLRAQRQTQEKTMDAANTLETWL
REAEGVITASQESMLSLNAKTIADASRLTQWSLDRLEQQRNAHEAFCEERLAQGAELLSR
MDECFQSFTEVWPEVAIVQGSSSDSEMAACAREVVSRVKLLKQRYSDATAQLPRSLLAVR
FVIIDMKIGEKLMEASEHLRQEELRIESGEEVSLILREHEAYFFSPDFIEELPAMMVEME
HILEELVKFEPDLAAQFAKRTEVRGKTLFQLKDRVEHFASNMRDLPERWLDFDSKLGGLE
QWTSELENLATRLCSEGLPGGEDMMDPKVAAEIAQRYRDMLKKFEEMVDSTSLNISLAER
LNKILQELIAEGGLSPPEMAKRRASLAHVLNGLHDIETVTPNVLQTAENMVDSLDKHVSK
AIKQDRTKRFRSHMEEIMSDPTTQTIDSDEMRRLLAEREALIARVNEEKKASLVYLMQIP
TSKATHTSQMPPVEERFLQVWEDADRMLEEKAANLRTAAQATEQFEGVRNRLFNLLGEAQ
FLLKCSAGSAYESKLTDGAPVCSYEAFATLSNKGVKQHDNIENIAAYGPSKIREQTTAIQ
THLKSLEKGAADITKLRGAADLIAEQLGPEKSAELESNINQLEREMALTKSALEERLTAL
KMADLQWASIHEHAQQLEESLGAQENTLADLRLHIETASLENCSDTVSVCDTYRKYLETY
AQDLRKLQSDAASLGSEIGDVNSTLAGMLTMERVDENGIVVKEVPEFVDPEVTAVQKNMN
ALLLRQKGINNACLSLEQIITSTLAALEEYSKLSGSVETYLNRVEAARDMKYAFSDLKEV
MAAKGQLNSLLTLRQAEIESATWRMRELSPFLKKVPQTAAAEAKLSQSLEAADGWMSTQA
SYIDALTTDWCMWSNEMDKISAELQQLADNVERVDTDATVDITQRANQAARQLEQVQLLR
ARWKALRPQTEAVLTLLSGGSKSSQLTMESAHHGVPQRYTMVGDQLRDLFSILQDMNTKL
EGELDAQDKFANDVERLVHMVSVAEKRLGKVTGIWIPSAPTLLAHVTQPISQIHVDDYKP
TRDSDFAVENTVDSCINLTEAVAELKSLFSEITGPMRTTIDSLLAQVKQFDTDEATARDR
LQYLLREISLLAIRTLKRQYICEVSLAYEQNRTNWVNKLRGLRSLQEQLIQTGATVEILN
GLPKTEETPKSLKTIPVDLSYQDDCIRWLKTLNGAKVQILSYKLTADLPKIPDCFQNVKE
EVRFEPEYTPQELDTASIVAGIFFVTGRRDEILSAAPTSREPFSFYVDVGRLISDCDRLK
TGMVTHWNFLEAYCTNWLRLVRGSEELGSNTTEFLEKTFTLVKSAVDLIDTRLDRPGNHK
RLFEITTQLREWQKAFESPSEVENLTDLPLVSRVLELQADGEKLIESVASRTLVVRALLD
ADRMVLLNASIRLCGIAYQLERLVKAYDSREAAIREVNNVVQEAEQEAGFRSVSHLTANL
LGVEVSPEMLAADELVGGSNLKTEISYKSDLESLLRTVLSSQDLSRLLARISKARTYLRT
HLPPKLMHLQQSSSAAICAFEAIMNEEHPKPSLERLADDTVRNRIVTRCQHFSDIMDEAI
KHLEDKHQAMTLIETNISHICTWIDELLPRVQSATHLLSVSANESAIPEAVQFAETVEDP
TDLLDFFNAEREHYAKIIELTQLEVNSDSEILCSVFESQTKSIATRFGDLVSAVSGMEDL
WRTYLAQDDAVRHELSRESDKLKVLTDRLDKINLQSGPTLLFTASTKERTDAMELLAQSF
EETQQIRSDYIDMITRVEALSNRCFNRDAFRMRLKRRKLLRDQMAEEVVEEQQVDVEDKS
KGHSDSLSKHCASLSFQLASVDTLIKRCAEGIGKRMMKVQADSVNAWSSEFNALSEGIEK
LKSFVELPLLLKAESHEAVPTFFAERRLDIQESQNRINNLESELSCTVSLHRVIQRLSHY
DHGPVASSIGDEVYSRKNRAMLAALRQNLIEYAIHVGEMESLLVEAFTSTSRLEAALAEM
DRRLSVALTALEDSLDLHKCEISLAQFSAMKNDLNPIKSELRLLQSLSDHFHTTMTVAIS
NGSSLISVLGVNIREASPASQESASHFFAEIASFDKKFHWIVAILDEANDHISLLISGFK
QYEYRVMEARTWLHQSEISLRSKSEGIDGFHSLDKDEVKMYLMLIQNLVLSSSDGKRLVN
VMEVATADLLTDALKVNRWVGNVCQSPHFYCMTPHSAASLPQFREALMNTSQQLKEDLSK
YLSRLNTAKEQAEVKLTACSTFCDNCSRFIEWLTDCETKWNIPSVGETDYPIANKDMFLW
EKQTLVATYKQRLTDVQVHESLLKELFGSTELDYATDQSPIDGSTLATNNRLLDARKRFQ
WLHQCVVTRIASIEDDVKKTEEMEALLQAFQRSVESINRRYTTLEWEIVEISTWEKLKPV
TSEPILEMLEDVIQQLPHSLHTLTELSRELEAAKETMVDTSSSPRHADEAKEMLVKLRNL
RNCTEKYIKTCLVLSNSYRILSNDIDKFKIRISEKAYISELTSPDVCRLTNEEWFSLRNE
VLVEQSVLWQFEEELRNESFESKFSVTQAAFDEFLGAINDVAQTSASQCSAVCQFKSKME
ELRESFNNCKKIIADYQRGLEMQLSKGDLYHDELNLCQELLNEIEANLGEILNSASLRGD
VKTWTTDTQDLICNVTAIERRLCDFQTKELESLMAIAQSGEEFLPLAAQATQDRWNDLVN
RAMNARGAAESALSAVQDAADAFLNMLNWIREAEDKLNAIVNTPIGQPNKSLTEADESRF
MADEWSGLAEVRSLRLSKLTKIHSESVAQRKMVLSTTEDLGKLKGAPPSKAEASVIRDLE
LELADAYADLIDHCQTAVNSEHELLRTTKAALEDANSALNATEKLSDRAKSLLFHDDLGA
SLDWQQTCFNDFISIEVATVRELIDRSKKWVTLLPQPDGYLADNINLRLVEELEKIECKV
AERVEVLGKYVHSLSEISQRISAEKVWQCEFSADMNPGLRNAPDTLGKKREMIQYFETKL
TEIDYHIESVGRLSDDLDRLMTNDGAAFVTPPALVSQLQNLRQSLALQRQTADSQRARWF
QVADQHVHFIRDLFSTHSWVFSLAAESMRCWSVFQDVCKSAPPNLEMISWTREASLYTVK
FHEILSEIQKLNGRFALICVVGSGEVNTKIGLCLRDLEKYLKATEQLVERRQSLLDKSSL
HVGKFVRNAQRFSQAAEAFTTSYHQVLSASTELTNLVLQTLLDDVERGLSLDLNNLQKER
AAVQALAVEACSDELNLPILEPLEEEVGEDVKWEKKPIARPTDPPENRMLDADKVLTELN
EVKASLVASITGLYKAADALAVARKHQRQTRKSCQDWLLEASKQLEACRSLMLEQASSHT
ASLSQKVNSLVIQQRNLEVLLETHKRNKDRFSLALESEAELLNCRAGLLQGLKDECSKCK
IISNFALSDDCLEATTLSHGWENLVGEIQALQSSMADHLAKCEAASEAVAWMVEWLRSLE
KRIRVEDVPSIDNLRLTLPYRGHCLRPYLEEVEVIEKVMNAQQDVIKSWQNLNEEIHCKI
PEFDESEQKISAFQSEAYSVAQNCRPRLDASIETAKNSLQRNTQGLDSLNQVYQNLISYN
KWILAIQQHASTKNTSIPALLGQEAEITLEEGQEHVSSLISVVEHFSTECQWAGDNICPL
SAARLLSADMLSHLKVVWQSVRIEVQTLRQKRQSDVEALTGFSSRLTVLAVWLSEKRDLF
KGIRGEVNNFCSPSVGTYTEELNKQAAKLPPTEAAVETIALCLKKKEKLVSDISTLLKDL
NVKNRDFDFLRERLQELTILGIEGILQATSDTDELMEGYSDLRKRVSQLSEQSKEMLSLH
QNLMAILSAVQTWHDELRRSILSSSDFFGDRYALVARLDWLKNIETVRQKGDKRCADLKE
ACVRCLATSPSDLAPALLAATNNQLTEFPNLCEKIVTTHSLYTSILTVWEKVDMAAAEFD
ASSQLLQESLANYEVPYCENPSNLQAKVDMLSSTLDVLNGMKDVDSSASGLWLEALTLRN
KFSQLTEYSTQLKSILTEISTKEDPSLASTIAQRSNKLKSLIETLQQIIATWQRMSDHLS
EILRESEELGKEADEFAKEVEDLVKGEGFCTSVIAVNDLIERCELCMERYGSFTHALKMM
KGKLSSLTPHTNNSTILELQGALTNHLTQHTSNQQLGRSLIKRLKERLDTDAKLKADLGL
YNAALSEAELTLVKLTTFGRLIPNMSLPKPLPLSTIPNSEMNFNFVKFSNAVQDYMNQQK
QSVARHYEQLSRLQEELAGRQKEIYDLINQNMLEDDGSILSKNGIKCRLEELVGRVEEVK
KDDSACEAFILESNLQIAKIIDELGSCVDVFVHMEGDSRRISGDFLANSETILTNLNALS
TRLNEDAPLLSPIKKVHMRLPTDDQEWKNYMSLYELLLNEFDNLRQRVEHLKTTVRDEVN
ELARVADLRRQWVDLHSKHVAKLSQISTYVQQTPASLDMTSEENVISRLNAYLALVKSSK
VDLQTAVADYTHKATILLSSLTDTVKSFSSHRNQPVGMLVARIEGQKGHFEDAECQAERM
EKEITEEIAHWDKFITQLRAFQQWLLARDADLEAISAAETFAERTNGLRSLDETLQKNGG
PMLDRIVSCGCTLRSLRSNLTVINHATTWITDRYNILLKEVSERRNSLKNTILAEEELHR
NASYCSNFLEIQEAQLSELCEKPFSASSAPSTIDGFEERLQKLHEYLRQLEGSKSTHLVP
LDERIQSVKNQLKMCGLDQAEVNNAVAKISELWKRYTRLRESCIRVSTELEKLVKGSKTF
YKLTSEMNSWLIEQKETFAGLDRGTPILDYHSIHELTDQLANRANAFHRFYMELNSTGER
RLADCSSSATDMLNTARSINMPILQDGSSKVHSQETLIADLHKCFQSLHTQATKRRDEIS
SLLVSLTAYDELFMSLNTWVSSVNKEVTKEGTEDAAREMQLWSTPSSYLTIRSSHVLSQL
AQSHERVEQIGEKQAHLDILLSRSSQLLEEWGFSEVTRFAAQKAGTLSRRFVELTIQVKK
QIEKNSLILRNIERLQEARDAYNVWEKDVRGNFARTCHKDYSTEVLKNAKRVAKSLDMGD
VLLEACRQWALSVQSDALGSKAANPSLAQDLMTSYETLKSMISQKLENIEKHIAQQRAKQ
LTIASLSSWLEAAEQRLQAIVSSIYTPPQIILKSASFVAVMAFYEQSVASALSELCSLQS
ECSNKVGFEDDSQLSSRFYAFKVRLTQCIGEAEERTKNLNAYREASELVSIRQKLTLERY
VQITGKSTTIPETVSQLTDPPTTVLEALLSPYDAERRLTVLQGAYDELVIDSRQLLEMMI
DSADRLLSTTTEQEAFLAEVISERNEVLREEQTKLEQLTRKSIELLRGITESWKVFTRTE
EELSDWLMAMEQASARPMIKIEMSVDERRQTLAEMQMYQSSLSRKAEVVERHLNEAELMN
RQAPQFQTAEKAKQLTNRYFALVTSVQAQIDLYSREVVEFSRLENLLDQMCAKVEDYRSL
IEECWMEGRSNSHTELIRKQIMIKKVLKEVVDLKNSSQLGDLLSLTERVKTFVSATLGDD
ISRRVSEASVFLEDSNRRLEQALTLVASRLETWENWSLLVKKLGEELEKTDSSFKLSLKE
AKIPTSSNPDDVLKKRREAIDRLQELHTSLVSRKPDFNELRRLMKDTDGEVLDPLLYRQS
SEVCSRGKTLTLDIQTHRTRLKRSWEGLFAFSNRVNAADQWLLTAFVKLTALNNANPDGP
KATEFLTRSCEVLVAEVSHFVANQLKSLTAEGQDIVASKKTKKKMQEKLKAEPAGRVDAL
KHLLNQLEAMKGEAEGLVQVVDAIKMSLCTKLEEWDSLLATVESGETYLQVHLACWWSER
VDRTEEELLQEQYSMTSSLRLKMTQQPETVLEDIVNQIKGIEKRRIHLENASAKVAAPWT
PVKTPFNIQRRLQRVVADDSDITSGSPGADEPQTSGSKLRTRVENLQKAYEKEVGKMKVF
NERLNHWKALWDQQLLCESEILDWIQMKESEANSLFAGRGLDTLGPGTSALKKLHSELIA
KREVIDEMAAWRQDLLRLPQQENDPINELNCKIDALVHRIGKRIQMHKNFVSQAQEASQV
KAEVQSDLERMVQRLSRFSKVSKRHGFRRHLPSTCVSPQPRLLALQGHSTLYLRSPRTQN
SLRTAQSTSVIPQRSPSPLVVQVPSSPIAGSLEWLWYSPTSVLEQISSPVSPARTPVPIS
TSPSPPRLPIRPHRTSRGNLLGRSTPLINFKRKADLHSHRGFALSRFADIKVGDESPSST
FASTASITSPLPPPPLLLGRSISSHRPGGWRRWWSLQPHSFPDSGFLKRSRDSSSCADLM
PSRQTGPVLPSRPSALRATSDIARRRRRKKLEQKRQIDEAASN
Download sequence
Identical sequences A0A068Y9I6
EmuJ_000910400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]