SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000936900.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000936900.1
Domain Number 1 Region: 337-409
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-19
Family SH3-domain 0.00071
Further Details:      
 
Weak hits

Sequence:  EmuJ_000936900.1
Domain Number - Region: 414-444
Classification Level Classification E-value
Superfamily SH3-domain 0.000361
Family SH3-domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000936900.1
Sequence length 508
Sequence
MEERMRTITFCADVSKWSEVKIKIKNDLTLSEMADDEDWGITPNYKNVMTEKEQRFGSQA
VPGSVGHVDVNKLIQGVLKSDAESKKNSFPKASYGYGGKFGVEKDRMDKSAVGTDYRSEM
AKHSSQQDYSKGFGGRYGVQKDRQDKAALGYEHREELAKHSSQRDYAVGFGGKYGVQKAR
VGASSVGYGDAPEPSALHQSQQRAGVDTGQNRASELRARFERLALDRNKPVERPSRPQVG
RLKPNIFTHPMSAEEPKSEPKPAKLTQKFVSSMAQAFEKKKAATQEEEKTNEGVDEVWKS
EPVPKFVKPPSPESEPEVEEQSEKKLEEYKEMEPSYQPSQPTEPTEHNKTSNITAVAAFD
FNASQSDELSFRAGDTIVNIDKFDESWWSGCIGTRWGIFPANHVREIKSEAGATGASAHS
TSSTTATALYDFVASQSDELSFKVVLVVWSHWGSIWHLSSHLCVRKLTPLPIPHDDIADL
VDFPQFLIVTLPSFMTFLNLLFYTKSTN
Download sequence
Identical sequences A0A068YEF2
EmuJ_000936900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]