SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000956800.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000956800.1
Domain Number 1 Region: 1077-1154
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1267-1335
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000184
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 3 Region: 164-330
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000944
Family Fibronectin type III 0.0062
Further Details:      
 
Weak hits

Sequence:  EmuJ_000956800.1
Domain Number - Region: 355-418
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000543
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000956800.1
Sequence length 1573
Sequence
METLLKELQESSERRQQLSFENSEIKAQITGKIGQLSRSLESSSLTESHFEVEFPEHAPA
VAELKEAIENLKTQLRDSERRCALETLRYEELLLELESSQMRQKYESLEVVGGVHSSASA
TSTALPNGLEYVISRKGTTSTDTTSFKHSCPVDGEWDLSKRVPAPRGIALEKQLTHSAIV
SWKPPGFLQNEEEEVTAYHVYADGQFRSSVGGHEKCRALVENIDSSKQHRISIRTVTGRG
QSRDAECTLLVGKGANAAPSRLKASHITTNSAKLSWLPGSSNFYHAVILNDHELRVCPPG
VYKLFLTGLPPNTLHRVRVEARRTSGPSEPPLNTQCLQGNPSSVDYKRNSDTIKFQTAPI
GLPDPPKNVQVEAGPQDGVLLVSWRPVPQATHVLPNCKNEPLVQGYTVCINDQPFINVPG
IDCDHVLLPLQQLATLLKSPEFTLATRGARQLQRQRQHPPPLFPPQSHHSRNVTTTEEDA
SEADSSQSTGDSLSDLRNEEEEEEARSDPSPEELWLTVYSTLSANTALLMNKNGTAREKK
GSSGPASPPIKLIPNLLLLAAGSLETAVELFGKRLSKRLGLNENNAAAACVSLRRPNPVC
ISIEKPGMDAERSDNADSAEGDPGIVHIHAGNIPGIAKTSSPTSDALDSAEALLRKRQLQ
KHKYSDSNQYQQHQSQYRRETRSTGNRPSSHYARHPREDLFQAHGHHNYRNCHEMELPAA
ALETVHPRYYPRRSRSGRHLRATRSMSDENDCFQGREKLIRPPCSTESTESERHQNSLHQ
PFFSSTKSSLDLRAEKCHRRGCHVCQWHRSSPLRQYTNSRVSLMRRSKSLGRSHNLTLVS
SSSNDEGISKAYFQRLQEREQSKYQFLGVGDVTGQRFSRRWRPDWNQKELCRSDKLRVEK
SSFAKSAPKHWLQKITSVPEIHLSRGHADLDDHLRRCMHSSERQLFTDSPHCQHRFSGTM
GDRQQRERSWREEEEESCLGDDDAAVMSYRFDDPDDGPYDWSEGPVYPSSSRNRPKGHSD
LISRNTKTMVTSGRRTVSSGLEGDYRLQGVGHKNPKRGPGRRFQLEVLNQTPDRRPLSSP
SPRPTGAGDGCGFFVSLYDYDPATMSPNPGAVDDELPFREGDIIKVYGDCDEDGFYFGEC
NGRKGFVPSNMVCEASADEVTDFLRRRGEHHGRNCTTTSTGLPPGQMTKPHRTAAQHTGP
PERSAGHMEQNFAYYHYPQHSERAGRDRPIREKGRRTRLQRSVFAEEKQITRGGAETIGR
KRGESQKPLHCIMEALYDYDPHIYSPNVDVETELKFRAGDRIRILSEMDDDGFYVGQLES
SGRCGMVPSNFLRELPRVAAEGNTSLINSGASDGGDVYDSRPKMVYGVSGSRPTHGSKPS
HTRGASENRSMLRSSDDLGPVSRRRRSSGRTREKMSKQLSRGRVQADNLEDAEEEEDSMI
TSTVPPPNPSDWPDSPEVSVKLHSVVPLSTTAAAITTVTPTPEPPTLMDLDVNRNLVSSG
GDAELSKDSPESDGQGGVIYMDINSKKHSKNRKSTLSRNSSNEQSQDHGPGDSQGRRRSV
FRSPFRKIPHAIE
Download sequence
Identical sequences A0A068YBG1
EmuJ_000956800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]