SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000959300.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000959300.1
Domain Number 1 Region: 551-746
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.59e-30
Family Nucleotide and nucleoside kinases 0.00033
Further Details:      
 
Domain Number 2 Region: 424-511
Classification Level Classification E-value
Superfamily SH3-domain 1.78e-18
Family SH3-domain 0.00069
Further Details:      
 
Domain Number 3 Region: 307-419
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000276
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000959300.1
Sequence length 950
Sequence
MSVITGTECKLLRATYLLQGNLDKKNELSNHLSEPLDEILTDEDRTLLRNFLASKDLKNI
LTQISLLSRITQYSSKSSSDKSFATLHPIISKLRPHRPEDRNCLVALNKTWSEIESLLTR
AAEGRYPEAQELYDILSNDSIRELLVAVHDTGNFSYTTHINQNSVTTPVYVERDPAFLKG
GDEESDCKDSLNRPFFMSSPPLDDEPPTIRQSLRDRGIEPPSKGSQQLYLPSNLSPLSTT
QEFSQTLSCASFATPRHRQSSISESPRKSAKNHFPYHSLGRRVGGANLKHPALPSNVESR
LPEPGMLRTVYISRKSPEEPLGITLSTYSSSQTPTRSASLLSLLGRPTQREANKDPPKII
INRIIVGSLADKEGKLFPGDELIELNGVAATSLETVQKVMASATQKNVLQMIVKTPGIGQ
LKAHILSHNNPEEKVYIRCLFKYDPLKDTLLPSANLGIAFKSGDVLELVDSQDLNWWQVR
RLDTPNLPVGLVPSQTLQERRQAFNQQASGSNINKKIKRIKSIFRAADSSNLLVRSDLWV
YEEVVPWPPSPVHTLLLIGPNGVGRRTIKFLLCTKFPQRFSFPVSDTTDSTATPTLFHIR
TKEDMESDIRRGAYVEWGSVDGHHYGIRFSAIREIIASGRTALVDCQCQSVHLLHQPEFN
PHVIFVSAPKFETAKAMMDVGIRENLTVNKRTDEEVRKVVEESKMFAIRNQHLYTHTLVN
NNMAESVEKLLQLVLRLEKQPGWIPASWAYELSLPNSFGKDGKYKHRFPRLSILSGLGIS
GLFEDNRSVLSRVASSILSVASPESAVRLARPPSVCSSLQLPGMASKRNWGGAAGSRWRY
EKRGAMQSAEPPLSSLCSSADSETGGSNSALPAYLSNGRNLISKAAVSDIRPMFCGSESS
KPSEPINQQICPANATKSRVLLNSIRKDAKATDSDDDDDDAISNTSSEDE
Download sequence
Identical sequences A0A068YHV9
EmuJ_000959300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]