SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000996500.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000996500.1
Domain Number 1 Region: 454-518
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-22
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000996500.1
Sequence length 519
Sequence
MTVTESDLAESRNALIRTVREIQQAAKYCSGNYITAASNGQRRSIDETMNYATQSLGTMI
HHINHLASAFLALLDERTEKMLEIEEKVAQLAMEVKIRREKVARKAIGSCTASKVPVKCT
LTKVRQDPPMEYVRRPIDYSILDHIGHGTRSQEPVTSPYGAPVVHAQTLTRRGSTTAHQM
GHHGNTINPKAMSIKVGGEYAATSVTASDYQSGTVGRTAGIYRTGVMGQYGNPYGGQQQV
LLPMGRNHPSTTVGGGSGGYTSNSTGSLGGPSRRSSSSSGNQPRTTGGYAPAGMHMAQPQ
QQGVPLSTGYATKQQVFTDQGSPSHEQMVPPHQGMFARQHSEPGNVPASSVQHHLPAQYQ
QSPQAPLNRPTDVKNVRPNDLPPPPTEIPTSSRPQMSLQLDGSGCAKSRSQGHTQQQQQQ
YSQPSTGGGIGGVDLSRLQPGPMDQLRPRQHNDPPWAPHHYIQKVITVYEYTADKSDELT
FGENELIYVIKKNDDGWWEGIMMNGRTGLFPGNYVEVIN
Download sequence
Identical sequences A0A068YIZ2
EmuJ_000996500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]