SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000997400.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000997400.1
Domain Number 1 Region: 214-274
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000013
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  EmuJ_000997400.1
Domain Number - Region: 14-119
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00046
Family BAR domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000997400.1
Sequence length 316
Sequence
MFFPDSSTCDLEKELKEVKNRLEEASKRIKDAEVIKRNYLANKNMHEKANVQEKEQEKRV
MEESRRKLSDFVKELDQCIPQMLAKNDEELYKYMLKYFTSKCEYLNSTLSETKKILNQIK
FARESDPAPSKYPRVSPLSPNSPPGPQAPSNGSTADDNAYTQPLNPLPKSATDDHRDEGT
AASTHPTVSNSDSRHNGLGTSTHDQANGELASRTPPFDVIAAFAYTSEEQDELDFKVDER
ITVLPWENSEDEEPGWLYGKHHGSGLKGLFPANYKKAKRAYKIQGNLVEPPHFNFEIAVL
IELDLFYAAVCANYLF
Download sequence
Identical sequences A0A068YJ03
EmuJ_000997400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]