SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_001034200.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001034200.1
Domain Number 1 Region: 256-441
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.35e-38
Family Nucleotide and nucleoside kinases 0.00000296
Further Details:      
 
Domain Number 2 Region: 32-148
Classification Level Classification E-value
Superfamily SH3-domain 3.66e-23
Family SH3-domain 0.0000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001034200.1
Sequence length 806
Sequence
MNRASFYGNTVDRSESSDESSDEDQLLLRAELREQEQRALVELDIALNAPVAFCVRTNVE
FDGLLNGLDAPIPTKVISFAAKEFLQVKRRFDQNWWIGRVVRDGSLIGFLPSPSKLETLR
HSIQTNLSQLLLSEALNVAASSSSANASSSAAASSGSGAGTNSLNSTKASAWPAALANGN
TPHTNDKHVFFRDGKPKGTETLITPGLGVSLPDMESEKTAAQAVPSLATTLPSTPKKKPF
FKKGFTGPPYDLVPNVRPVVVVGPALKGYEVTDMMQKALFDSLKRHFEGRLIATRVVSDI
SAWKRLNVLVNMDKKALTDRTRGRQIITALEVQREIERIFDLATSMQLVVLDSEAINHPH
QIAKSPLAPIMVYIKISSIRVLQRLIKNRGKTQKKQISSQVAAAERLLQCAEESFDVVLE
QNSLESATEALANYLESYLKALHHYRDHNKGDRQFSPPPSHMSLKTNEAKPLPPMIPGRP
GLNIAFAVAGSAGFQLQELAALAGDRHAGHSSTPGEGECEGGNEGEEGDEEREKKEGKDE
VKRGEGEGDKADHKMDTDKTDRESKGFASAEAKKKSLSALKVGKAEGKREGGGILKLGAG
KKHKQTLTQIIPDRAHAIALAEAVVKNANAAAAAAAATRLDVPGGATIGLHQSHQAAHSD
PSGTPKIYASRSSRQAKQRQEEMENARRRSEEAARAAAEARAASGAQRQEKRRQRRLLLA
EQAAATAARYGGGGTVKFGDNVSSEKGLVLDRGSRARMPPDEESQSSPGSNLRRNTSSAT
EASVPLGPKSPYNKAIPLIIHPPSEN
Download sequence
Identical sequences A0A068YDJ3
EmuJ_001034200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]