SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_001064500.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001064500.1
Domain Number 1 Region: 282-337
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-22
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 2 Region: 33-225
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000155
Family BAR domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001064500.1
Sequence length 338
Sequence
MSRIKAKFHLTKGNRSVLNLDGAAGVDDLSECKKFYAHLESKMTSVLRPSRHLHSQVPLL
KNNKQENYHYEEKGFVDYLNRFCDSLTGHVREAIQAMVATYQQIADLKSQRDSNMRTEVF
SPIKETTLKEISNIQKLQRLVIEAQNQLAAAERNREKDGSQQATDRRDQAFRSHSEATER
LKKAIIEFKQDEPKRITFLQASAEAQLEYHKWAMEAFTKLVSELRTIRGNAADNVPNTTL
DASLNGGTTYYDKPQSNFGYAAVVKRTPSTAQNDAQKTTKALTNCKALYDFEAEQDDDLS
FKKGDIATILEKVDDQWYFGEKDGRRGHFPVEFVQVLE
Download sequence
Identical sequences A0A068YLA3
EmuJ_001064500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]