SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_001116400.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001116400.1
Domain Number 1 Region: 58-120
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000021
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 2 Region: 98-219
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000429
Family SH2 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001116400.1
Sequence length 236
Sequence
MKNELLLDGWGSPVLTRPRLVTDIRSLRQLPVKRSVASSLSSFSNRLIVSILRIMEANST
WAFALYDFKATEDGDLAFRAGDLLRLSKSHQENKGQNWLAATNPRTRCFGEVPANYITSE
RGYSAALDAFRETDRNGASKLLQSNDYSSNFNYVIRPSRECNEMALSIKPSKGNVTHYKI
YFSGTDLNCFLFVNKTFKTIEDLVIYYMENAIAPGCILQAYKPFKDSLPTNPQVAR
Download sequence
Identical sequences A0A068YF39
EmuJ_001116400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]