SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_001125300.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001125300.1
Domain Number 1 Region: 407-682
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-81
Family Protein kinases, catalytic subunit 0.0000000271
Further Details:      
 
Domain Number 2 Region: 287-441
Classification Level Classification E-value
Superfamily SH2 domain 1.99e-33
Family SH2 domain 0.0000523
Further Details:      
 
Domain Number 3 Region: 228-310
Classification Level Classification E-value
Superfamily SH3-domain 1.6e-19
Family SH3-domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001125300.1
Sequence length 786
Sequence
MGNCMNKCQRTMGAEEYHPITPHTERPLPPRPLSGNLPNGLPDTLCLEPISNVVDNEPYP
FSFTSTPPPKSRQVFTGYHADSRDKVNIFPSHDSPIAFSSNRPVAVTCAPCVSSACPQFH
PPLVSIAQRVPSSLLSGHSSRSHSLPRANGNGSTPKNSIPYSPAMIARNLEAESHFKRSV
EFRNSPRTPRNDVTERFHRASIGASIDTRSAARHPFADPQSNPSELSNRLVAIFDYNART
DEEISLRKGDSMLTLNDSDAEWWFVEHCRTSEKGYVPSSYVAVAGSLEAEEWYIPRISRK
DSERLLLLNSNTPGTFMIRDSETAQGTLTLSVRDREVDAATSHATDTVKHYRVKQFGGGG
GGFYISTKRGFPSLRDLVEHYSAEADGLCRRLTRACPRPPPLTTDLSVQTKDHWEIPRTS
ITLLQRLGAGQFGEVWKATWNGTTEVAVKMLKPGAMSTEEFLKEARIMKAARHPRLVRLY
AVCVEDPIYIVTELMPHGSLLYYLRDGPGRHLTLRPLIDMMAQIASGMAYLERERYIHRD
LAARNILVGENNAVKIADFGLARMVVEERYETYVAQNGTKLPIKWTAPEAALSGRFTVKS
DVWSFGIVLYEIITHGQVPYPSMNNTETLNQVSSGYRMPRPSACPEGVYEVMLQTWDATP
ERRPTFEYLCAYFEEYFVASEPTGYHQRDHRNATITNEPSPGGLLRPRHLDEGVIEVVEK
LDGVEDIDADAMAEGGEEEEEEDLDAEIINLARTGTEFHHHHHQRNHHSHTHHPSHNDAP
TPMAVV
Download sequence
Identical sequences A0A068YN67
EmuJ_001125300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]