SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_001169500.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001169500.1
Domain Number 1 Region: 335-430
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000236
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001169500.1
Sequence length 471
Sequence
MSRQNDSAALIECLRTGNEPPGDVLITHPDIDAPPCTPSRSSNDHGISNHRSAKTENGDG
GTYSASVPVSPGPSANGSFFIGADPIVEPTETHRLPTLSSTSYPSLSRSARRFSVSSMGL
GSNGNAGAHSSFLWKVFARRSKSREAERRSDATTHNARVSGSQSQRASPTKKLEIIHVDH
DKMKEPAENVGDTSDAEAEEKEGQGQQQSTPTLSFRSAPPFKSSGSTQAMAQTTTELSRS
LSSPSSSSNSVRGHKNTLTNPRTVGIPGSQISGYDKNGPFRNTSPCSTQFSKGTIVGAAP
TSHAAHQKSLRSTSPRQAIHQPKRQHKGNHQTRKPNSETKPNHQSNMSDLIVVGTCKALY
DFESSQYGETFLSFKTGNKLKVISSAARWHGSVDADGWIYAETIPPNEGSRSHPQRGFIP
AGFVEITLYPEPLPLSPPRRHEPDEVASHRRIHGHARGDNAYLALGQATEL
Download sequence
Identical sequences A0A068XU15
EmuJ_001169500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]