SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_001170300.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001170300.1
Domain Number 1 Region: 611-717
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-23
Family Ankyrin repeat 0.0000179
Further Details:      
 
Weak hits

Sequence:  EmuJ_001170300.1
Domain Number - Region: 765-836
Classification Level Classification E-value
Superfamily SH3-domain 0.000192
Family SH3-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001170300.1
Sequence length 930
Sequence
MPPVICSSNYPRQNHSTSYQTPISSEERAPAAPIPARRQFSNHHYHLPPNPPLQRLRSPP
PPSQHRQQQQQPFPPLPTHQSQSHFTIQMPSSRGTAFKKLNNTAAPPPYDSLRSVIGNPA
NQRIHHATGPPLPVYFSPSLTASPTPQMRNRNATPNVGTPVGGAILPGAKKTSPLPSARL
QHQRTEVLSPMYQLPEFVNSPPRNLEVSPKQKTRLNELRREKATYEQLWRKNNQLASSNS
AMENQVTVKDRELKSCTRRSEELSTKLDIIRKWCEWLVQPPNSQLARPDRSPYFETNEDT
TRWKRAFDELCRLDRKIGNLRSQRRSHPTVSRLNATRPSTTSSPAHFPPSELPPKPSTER
SGRHSSAGAQKRDFTPTPSPRLNRPASAPVDKDAPAAAVAANTTKLSPPPPRPSLPAPSP
ILHKARFASRKEINATYLTPPQWRNEHTDEYKRTASENLQAQLASQQLQSIEVLLPEAKR
LSLTDAPSSVSEVAIPYSEEDSTSAGSSSSSLETPKPVRKVIRGPGSRVFDGSEDSAIAD
TDGSPIVSQESPKKVRSEEGLNAGTKPILRKAVGDGEEVEERREEGEELKAMDKVDPGSP
KTGVRFHPLALLLDAALEGDLALVKKAAGEVSDVSEANDEGITALHNAVCAGRVEVVEFL
VREAGADVNAGDTDGWTPLHCAASCGNVRLARLLVEHGAALHARTLSDHETALEKCDQAD
ADAECERYLSAELGLLGSEDSGRVFALFPRGLEAAGPGSPDANIEPDELPIWPNEELRII
NRSPVGEPDWMLAEKVGGDGDTLPQRGLVPRAFISRFRIVRVPPASRPMPLPPPDSVGRF
SRIFQSPSPIEEEEEDGQEDGRVSYMENESGEDNGSPQMVERAGDGDEEEEEEEILTVEV
NNHDANDETDKPLNGSSDISSEEKAVRTAM
Download sequence
Identical sequences A0A068Y035
EmuJ_001170300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]