SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000023200.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000023200.1
Domain Number 1 Region: 215-345
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-27
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 2 Region: 304-443
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-27
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 31-135
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-27
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 4 Region: 131-249
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-18
Family Spectrin repeat 0.00094
Further Details:      
 
Weak hits

Sequence:  EmuJ_000023200.1
Domain Number - Region: 3-36
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0416
Family Spectrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000023200.1
Sequence length 445
Sequence
VIEKKTEVREALDRLKELARKRQNKLYEAHEIQRFFRETDKAISWLNEKSIPLAIEDCGR
DLVSVQALQRKHEALERDLAALEDKVSQLSTDAEALSKEHPDSKDTIQEKRNTLTTAWQD
LKAKSGDRRAKLEESFLLHRFLADWRDLTLWIADTKAIISADKLAKDVAGAEAQVERHNE
HKGEIDSREDAYRSCMEEGQRLVIGGTRQGTRGCHKKMNTLQNERDSLLELWEARRVQFE
QCMDLMLFFRDTEQAEAWIAKQEAFLENKDVGDSLDAVEALMRKQEDFEKSLTAQEEKIR
NLEAFADKLIAGNHYASPEVAERRESLLRRRTALQDKAALRHQQLVDSHRYQMFDRDADE
MKAWIMEKLKTATDESYKDPTNLQTKVQKHHNFESEINANRSRMDEVKKMGIDLIDGQHY
KSDDIRARIGELDDLCLQLLDAMAK
Download sequence
Identical sequences EmuJ_000023200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]