SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000366500.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000366500.1
Domain Number 1 Region: 226-442
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.71e-40
Family Protein kinases, catalytic subunit 0.0000301
Further Details:      
 
Domain Number 2 Region: 106-232
Classification Level Classification E-value
Superfamily SH2 domain 7.75e-19
Family SH2 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 53-127
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000328
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000366500.1
Sequence length 458
Sequence
MRRHYFFRKFRNRRRGKGDRSQTLPRQETIPSPKPHEYVDAQPPSRQESNLYTNLHNRLG
SPHPQPNTPTGTFPVEAICGFTATQPDECGFIVGDLLCVTNTSSDWWIATNLRTKEKGFI
PANCVTSDMSLSIVLEAWFDINRLEVECRLLLPAVQTGTYILRPCKDPRSPYYLSVRALG
VDTKHFQVCFDGQAKKYHISGNEQFSTFRDLIMHYHSRPIDGEVGLIEPCPRKVDYVIQH
KDVKMGKEVGKGNFGVVYLSHVRGMEVAVKRCFSITNDQAFREVVEMMQKLSHQRIVHFH
GICCDAPDDRVLIITEFMVNGALRDYLRTPEGRQLDYPKLVCIIVQVFPYRWTAPEAMEG
SFHPNVKSDVWSFGVLMFEVLTYGETPYKDCTRTQLRKFLSEGGRLSSPQYHGCECEARV
YCIMRSCWDSKPEQRPTFKKLKYEIEQCILDGETAFGI
Download sequence
Identical sequences A0A068XW12
EmuJ_000366500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]