SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000468000.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000468000.1
Domain Number 1 Region: 1446-1632
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-40
Family DBL homology domain (DH-domain) 0.00000396
Further Details:      
 
Domain Number 2 Region: 1642-1760
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-25
Family Pleckstrin-homology domain (PH domain) 0.0000526
Further Details:      
 
Domain Number 3 Region: 435-572
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 4 Region: 1037-1175
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000209
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 5 Region: 658-796
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000064
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 6 Region: 765-899
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000132
Family Spectrin repeat 0.0098
Further Details:      
 
Weak hits

Sequence:  EmuJ_000468000.1
Domain Number - Region: 1782-1817
Classification Level Classification E-value
Superfamily SH3-domain 0.0858
Family SH3-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000468000.1
Sequence length 2300
Sequence
MDHSSKHIDSEVLDFYRPSHIGENRLSSSGHNCHLHDQHSSGNQHRSHGVPQLPLHVKAG
SSLRVPLTAAVHTAYGIHPQLPRVYQQGRPQSASQHHLGRQVHPEIFRHSPQSCQSNQSG
CTASVSSGTSGYASLNSNCKGGHKPSGARLRAAELIPLLRGKYAMLPGGRTRNGGPILCF
PANSHADFLPLEELYFLVLYLTYLPEENVKKLGFAVIIDMRSGTTWHSVKPVLKVIEECI
GGNVSMAYIIKPDRYLEKQKVQMSIGKFSFSIQLVSVEQLFLEVDASQLTADLEGTLPYN
HEEWIQIRCCLEEFFMFAHDMSDKFSQLYCFLDQKQNPESVEESKRALEDHRSVRLKVMQ
APVPALEAESDRLTAWLRYGISAAASASASGGAATAVSTAAAGLPSSVGNAAISSGASYV
PSSWVSMNPDFQQLIPQVRQTVTQLYEFRAHLQQKWETGRTRLEQIYQFRLFEDDASRMT
AWLEQQSVLLLTEHADIGETASQAVELHNLHRQFLQKCSGVREQVSRLTGIARMLADTGH
FAGQQMLKQANELEHERKSFTTALEERSRVLQLSTSFHTRAEAFLNNCTTWETSVRHVSG
TNVNDLNQALRLIQERWQDIQRSYEEACRDGRAMVDLLSAPVTGGSHTSLTAAIDYSQGR
KHCADLVHELWAWYKRLERTFTDRKSRLTSRLALLMFKEDVGQVLTWLSDHGEPFLARQT
AIGKSSQRAEQLYNAHMQFEQVAANTLTNADKLISAVEELASQAENPREVRQEAAKLQQR
ITSFTNAVDSRREMLDLACGFYGHTKEVLNWLHNASEAYNPGEHFPPTIEGMDDELTAFR
QHRDSLEAAVKRVVSEGKVLISRLQDSEEAAHLRSILTQVTNERDAVWELLGDRQMRLEL
CMQLRLFEADVHNSMEGLRRDVPAITAVVNATSTVPSTSPTAPTAATESNVASAAPSTSG
VSSISTTATDLYWISDPRKAPSISALEEVNVSCTAILPKVEEVLNKGGELIRIFESVAVN
FPAGGPGSSDSGVGDSSETAVERVHRLISELGESVATVDEINERVSNELDWRRLQSQSRQ
VLKWIGQCEVILYQTAVIPTSLAEAEAMQTDHDKFQPVLNDAHPEAVQCAARASYLLQSV
AADHPRRADFQAVAENVAERWQKLVYAAEEKHKLLIAATNWYKTSEQVISVLRSLEKDYR
REEDWCRSDKALNSGNVESYLNDLLNKHGEQKEAFLKACILARRTSELFMKYLHRQPPTT
ACRTKVEERIRSDMADLMAKEQAVLEAWAAQRRRFEECVKFVTVEAEMLDLARRILQFAG
GPVKSTEDPKVALPLLPRQSSLFATVKRACQSLKALLEAGVGAHHSDSLFKTYHRLNACV
APVETSRPPESDSASAAAAKMRFTGTGSNRTSVSSTGSSGVASSDTTPSITATVGLTEEQ
RKLINRRQNILRELVTTERAYVLALRTCLETFHVATMNPPVDIPVPSYIAGKESIVYGNL
EEIYHFHEKFFEPEICKYASGGDFLPEDVGHCFVSFGDRLAGLYVEYCVNKEDSMQILVA
DTENFFGRLQLRYQLSEPLQSFLIKPVQRITKYQLLLREIRECCDKSSAGELSEGLDVMM
AVPKKANEAIHLRMLQGLPEDLPISCLGDVVLQDQFTVWEPKQLIKKSRERRVFLFDICL
VLAKECPVNPGESKMKYQFKSRFLLADLNITEHIEGDQCKFALWAGRVPPVNDYRLVLKA
PSLEVKQTWVRAIREAMRERMFSMQSLHQDSSAASGKLGADSVSTLDAYYIRENYQAQGP
NEISVAAHQIVQLVQRTTHPSVESVSTPPPTPIGSASAEREADGTSEPSWALVRFVVTGS
ASSPNAPVDEGFIPARLIGAPVYPRAASVTAGGSSGGRRSMRRWLPSAGSGTKERRQVLL
GTPASGKRGSKADMAPPIPLVNRSLAATTQHSVTSATSVATQDNTALLDNVSEESVELEL
PPPMVELQALPTASAVTSAVESEIDVASEVKRAEEDGAAQVSSRSPSTLNISTMGGELQT
ANSELNLSRMVEISGEADGSGGTGLHLPPVLTGVPSDLQQNALGALRLHGGLRVATQLVG
ALEASLADLTIGGSTATDASPRPEGTACTAAQEEELLKAIAEDSTTLCFVNRHLLLFDQG
LVIADAAVEAISRTDGVTRQMRCQFRHFLSFSQIALLEDISVAGSRPTEEQALWFCVSER
PRRSTTSAVCGGMGGAEGSLQSHLCHVLAPHSSEVRIRWLSELNAALEQGKRYSAIVTVS
GDEASSMSPPLPTKENSLLA
Download sequence
Identical sequences A0A068XZ26
EmuJ_000468000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]