SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000486600.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000486600.1
Domain Number 1 Region: 9-254
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.25e-73
Family Calponin-homology domain, CH-domain 0.0000359
Further Details:      
 
Domain Number 2 Region: 3175-3311
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000461
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 3 Region: 3702-3857
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000107
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 1112-1243
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000327
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 5 Region: 3820-3944
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000038
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 6 Region: 642-764
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 4412-4514
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000311
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 8 Region: 3929-4043
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000602
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 9 Region: 1438-1582
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000072
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 10 Region: 2524-2648
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000153
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 11 Region: 2069-2194
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000336
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 12 Region: 2668-2803
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000475
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 13 Region: 889-958
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000206
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 14 Region: 372-497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000419
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 15 Region: 287-400
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000432
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 16 Region: 986-1093
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000985
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 17 Region: 3604-3681,3716-3748
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000576
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 18 Region: 2395-2534
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000739
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 19 Region: 1652-1807
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000102
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 20 Region: 2158-2234,2265-2303
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000102
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  EmuJ_000486600.1
Domain Number - Region: 1863-1992
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000114
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number - Region: 2784-2920
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000489
Family Spectrin repeat 0.022
Further Details:      
 
Domain Number - Region: 3284-3423
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000959
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number - Region: 1332-1419
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00689
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 546-634
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number - Region: 757-811
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0768
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000486600.1
Sequence length 4564
Sequence
MATSAYLDSIGHGIESVQYEQNTINRLHAGAARVQKKAFTTWINFYLKPCNMEVTNLYTD
LSDGKRLMKLLEVISNAKFGRHNGGALRVQMVENVGRALEFIKKKVHLENIGAEDIVDGN
PTLILGLIWTIILRFQIEEAMLQIEPQLNGSQRSAKEALLLWCQNKTRGYANVDVKDFTT
SWRDGLAFGALLHSHNPEAIDMSKMLLDKPMENLTIAFKTAEQCFEVPQMLDPQDVNVPK
PDERSIMTYVASMYQMLNKHRNKNKNANRVGKTINQAIDLRSKINWYEVGIRSLLQWIRD
KTAFFRKSVQSLPVNLDEVKMALFNFTQYRRVEKSQKYEEWIELQEVLFSISLLTKELRA
RPYTQTDPQLKIAAIGKAWEELENAESDFEEAIRKAYLRLEKYERMVRQFEHRAAIREGW
LTDMEDQAGHLQQLPGTQAGAAKKAEALKLKIESNEKRFKNLADLALKIMKYGEYPQGSS
VQQRNAALQSRWSALSGAKMRALLARIAFPQTRAELMEQLKIVTRKIQELEKQLTQPTKG
ETEARKSDDKTLPLEVIQAALDRHRIAEAEFLPLERKIYQIRNAAEATWTNAAPMPNADL
EKASDFQKCQAAVQLWNRVADESRKRKAKLEGINSTYGLFASLANELNWVTEKKDFLAST
VGATKDPRNARDLQLAQRLCKKHQAMESEVAAHEPSWDDLKRLAETFLNSRTGGSNVAGD
PLADTRQSVRSQIAAITSSWSQLREEMKIRENALNECLESAQFYADADEASRWIREKIYL
VEAAGILSHPVESEQELNEAIKMCGVDSSSTMAQKRRLTNLETEMQAFQSNDMERLKYFS
TILRNPMDARPLRTELLAPNDADGSSDIDSDVETSLSKSYAFPKNIEGRAQATGRYTAKD
PAGRDIDLEEGEIVLVVACTNADWWHVRKNVRGQQKEGFVPANRLRLLQAPVVGRQGSKA
DALKAVKREVSRGLTIRKAPSARSSNELHFDRENIQKCEQKVNAELSQLQKCVKARDNCL
EDTLAWHDFTMKGNNFETWMKQKIDQLQRDSRNVKSHGPGSTHIETTIEEISKGTSLLAE
INEIADILTGVVKPSERSLYKRGSGELFYKKPAERRMKDIRTQWDTLNKRKTSLEASLTS
SSGLGQFEKLAETMEILLGDRTAQLETMTNTASNAETNTELLQRVKEIKVEKPLLGEKMS
RLRAMSNSVAQTYPNDAPAVKARLQAIERLWYRLQDLLKRREDAYSLAAADFSLREKMKD
LEGKLNYAEEQIDTLEPAGEIVSSHSLFQSLLPPATLHQRLQKADELDDDLTIYDAAAAE
LCDEARRLPGSSTSKDKLSSATDALALKNEELKRKLGAKKDNLTSAVKAQNFASALGSIE
GNIKELDTRLQMTEPLTSLTDVDREKRRIEGLKIELLKNITAVTVNEERIKAAKLPKDLT
NPLLSKSESIRNAAGIVLKKAEARGNELEKVMAHVNFHNDANDVEEWLEEKKASVQSVPT
LATGSSPMENLRQTRTRIKKLGDIESELAANQKALDELRNRSHRLPSCVDAKNFPNPQKL
AQDLNDRLLDLRKSISTKVKDLTNAESAAQFNSEADQIIKASVVAPQLAAVPGDLAEKVI
RSSQLPRNYAEAINALNETERNRHKVMGDLAKLDDLEKKAKKAGAWTPELAAQIKQKKET
LQKQLDDLDNEEKRNRDLVDWYKTVDEMNMLKDWADDQAGQERGHMRRNASFRTPQEHAT
QRKSHERLRDEMKRKYPRVQQLLDVKRRPIPACLADDELAKEVRPNLQRSWANLQSVVDS
RSQQLDDAMSTMNLLCEMADLAKALNAKAADVDRVVNGKSNQNDDMATKKMLEVEKYTKE
TEPKVTNLGNRVSRVLSASSIEPNLAKPLKNGIVELEGSLGDLKDKVNSAKRSLFFQRRI
NAFDEKVDDQQQDITNALAFISATEIGDDPEQIEKIRNRWQTFITNLPKLVTGVDSCLIE
GRGLSDDLDTLINPKMRQATQTATVPSPTAFGLTINQMATQPQSTYPFCNEQSVRAGADQ
VRSQVECLARDKGLLQEQVRLVQSRMDRTGDISHFSQAWADLMELMRNRSAHLTALSAVT
PKSTSTLAAQVKKHEALETELVSIQQQVDDVISEGQELLSILRESKPHGGRRNSKTETLI
SDRSQCLLDALKDLEDKMVDRRKQLNQWSRYLQFSEKVRDVLFWCNEAEQEIITIEPIAK
TAAEAFAMMDQKFSTGQANNNSRVPESIDCSQAELLQANCFRMSDELQQRWKPISIQLVA
EAESMIDANHFAASDLKNKVDQMVIAQRSIEDGLKNYNRWILQLLDLLLLKREISKFSSQ
TVIQRARIDAIMEECSSVQTAPKYASCNKLHSSLDVKSMIQRTENIVKVMKANDDKVASL
VSSANLMIQKKHYASTQIHEVINRMQIARVSVGQICADHLESLNRRLEQVVWEEDASDTE
AWLTERESELNIMMTPKALHRSQSISKRSSFIEEVAAVRTQLEMLQRQDKFQTSILGNKD
HIDEILTRGAKLVEAEGKIPTREGSTIGQDISSRCTNIRRRWKKLRDSLASSSSALEASR
DLSRYQNEADALEGWLREKDILLAKGDFGSDYDHCVSLKDKINEPAAGKIVNDATIRDFR
SLSDRILQSLCKSPMGTHNSIVVLNKQTSDYVDRRTADICDRWDRVQESLSRYAKLLELA
ATIHEVVSKVDGLLIQISNRKSKASVRDDLGKMLTVSELEALLRELQTNERDVAAIEAQT
KKVEEEAKNAVESFASNVPKTQTSALIQQINSKMSNLEAVTRETKVLQKERRELLESKLA
AQRILEGCRQLVDWSNGVEKELKPHIVGTAMVGLVGKLAMLKAGKSAAMDGEGGEKRRVF
IARMRRRLIDCQSELPLRQQQLTRLQSQAQQLKSETMERKAVPGEIKQADEALKRAANIL
ARLEIQVDIEEKRQAFATTGKQEDRWIESVQSQAQQAVKSAFRGLAADSDDSDGETDQPM
IVASTNGIQQYAAPPSEISPQACLAMLDSLASSLEDRNTMKKQFDELQQCHTTSKEAKEI
YTPDKVKEDKQLLDKTQARALMTSQMIAKMREQVETRTECDNWFVSANESLKWMKENQLL
AATTYDWRVVLKRFGENIPGSENDQTCGPKGSNGMARKMAAHRRFNVDIDIGLEMVDRLC
EQGEQLVRLNPKKATKVSQMVGQLRAAATQLRSTCAERALRLNEANELVKWGQLMDEALE
AAKHAEAQLMSDDYHRGENGLKRLLDKHEVIARDIQETQRARAESLLKTATEAEKKGHFA
GARMVNEAKELINTVEVTLPQLAQARLDALQLMITWRRLEKDLRVENDWLKEQLNSSLLD
IQSSAMQNLDQNTATRQLKSLSELASCLAAQSPKIDEIVEKVNKLTNDDSQKTKSLLSDL
GTLQEASHLANQLMNQKSELESRVGAVGTCLITEHMYLQHVHDIQEAQEWIKAHLYPVSK
LAPMTDSSGTKAALQNVSRLRDDVSAFKRSTIGQLSARLQQRSFTDDANVNNFVPPEERT
QAIVSDDLRKLVEEHQGSTKNPNQKDMQANLNREMANLLTNFDVLSAYLELIEVRLKLRI
KINAYNTQGDEFNQFLSSFDADIESRDYGVDLDECETLLAKFTERMESTSNSGTSHLTNL
TNRAKQLTETADDLMGKVDTEEQRVKKSRMQESDGWTSVPQELLNLRGDVQLDMKTVQAR
QVELTQRWASVRTGMKRRRENLQSAMRIHVYMSDVDDLLEWIVDKSPEARDNQKSAALLG
RISSLKATRPEINPQTSTGLEKALNEQEKLRREVNAMRKQVEKQEQECDRLKQDCPDRAP
EVEKQWKRLETAWNSLQIAVGGERQRLSEAQKVTQWQSRCDLLCGWADKQRLAMLAVQEI
PNDLSEAHGLLDTHRQIRLQITKRTPEREEIIRAGQDLSNSIPSSKIVIQKSTEKLETAW
SQMQSLWGSRNSLYEKNLDLRKLYEEMAELDAWLDEQEQRLERTTNIITGDTSAINVDQA
IANHADIEKAVEDAKQRFDAIKRQTLVETLKFEFLKFMTKRNEGSRVGDQPFSSARIAEI
QRRETSKLNRNRFSSKHPTSTVKPAEQVNQENLQAIFGSLAPIEANVEQSVQHAAPPMPA
IPLASSQNDSFGMTNAHFVRRGSDSSDIDSLPASRVVDIKPTMPPREHRSPLLRSPSQKS
NSKLINLFRQSTNESITYSASTVTPTITSPEPRVGTPQRWGSKIFSKRRGNETPDSPAPS
TTETPKMERAVSLSSTLSSVPTRVISKPPPLVLDAKSSVQADYNSRSAASTRERAVDLPP
KAPNSTASRERDIWSPGDLSSTPVNEIKLNLTSDHSRATSTNRSPSVSLRQGENSPKASL
TGSLARKIVAAPKSYRGVTKKWLPHEQTAGYNWAVLEGSRLSFYENEGAPTIGTAPLAVF
NVQGAVVSHCLPKTSKTHAHVMQMKLEDGTEILLAANTLDNYNRWYDCLRSASSLGYSNN
NVSRISSDLSQPPPSSRDSGSNKTWTLPRGGSLRRKESGESGNHGGTWSRLTRWKHRNSS
VDKN
Download sequence
Identical sequences A0A068XYS6
EmuJ_000486600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]