SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000515100.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000515100.1
Domain Number 1 Region: 231-499
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-71
Family Protein kinases, catalytic subunit 0.0000028
Further Details:      
 
Domain Number 2 Region: 48-124
Classification Level Classification E-value
Superfamily SH3-domain 5.34e-16
Family SH3-domain 0.00063
Further Details:      
 
Domain Number 3 Region: 100-265
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000104
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000515100.1
Sequence length 522
Sequence
MDFHSFFCKLRNKNKARKDRRLNKPQEQQQHYQCYQQQQQKEDQLNQQQQQMPNLPYAAY
SYPRPPFHRPRAVLAVYDFEAPQDNECSFNKDDILIVSDTSNEWWQATNVRTKKDGLIPS
NYVSSDLSQSIVLEAFFDVDRAEAEYKLLVPGVQFGTYILRPCMETNIPYSLSVRAKGVA
VKHFRVYFDKAVRQYYLSVTTRFSSLERMLTYYQSNTIDGEVGLMEPRSHRVVVPMDLDE
CEINYAYLTLERELGRGNFGAVYKGRIGNMPVAVKKSLNENSDKAFLEEVKVMHILAHQR
IVRFLGFCRSEPDGRILIVTEFMANGSLLDYLHKPEGRSLQYSHLISIIDQVVKAMVYLE
KIKVVHRDLRAANVLVHEDRSVKVADFGLTLISGVDQTNVADTFPIRWTAPEVLIRSLKP
TTKSDVWSFGILMFEVLTYGQTPYMEYTKEQVSDLIEKGGQLQSPCQYGHTCDEEVYKIM
KSCWNRQPEKRPTFREISQKIEGNIRKRERVYYARWDNNSEN
Download sequence
Identical sequences A0A068Y6G4
EmuJ_000515100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]