SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000610500.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000610500.1
Domain Number 1 Region: 5705-5910
Classification Level Classification E-value
Superfamily Fibronectin type III 5.51e-39
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 10070-10111,10142-10360
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.12e-38
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 3 Region: 7150-7357
Classification Level Classification E-value
Superfamily Fibronectin type III 9.43e-33
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 6715-6909
Classification Level Classification E-value
Superfamily Fibronectin type III 9.28e-32
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 6521-6704
Classification Level Classification E-value
Superfamily Fibronectin type III 4.82e-30
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 4793-4998
Classification Level Classification E-value
Superfamily Fibronectin type III 2.1e-27
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 7 Region: 6129-6343
Classification Level Classification E-value
Superfamily Fibronectin type III 9.53e-27
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 8 Region: 7804-7984
Classification Level Classification E-value
Superfamily Fibronectin type III 7e-24
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 9 Region: 5199-5401
Classification Level Classification E-value
Superfamily Fibronectin type III 8.88e-24
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 10 Region: 6922-7144
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-23
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 11 Region: 1556-1648
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-23
Family I set domains 0.021
Further Details:      
 
Domain Number 12 Region: 2333-2425
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 13 Region: 5599-5693
Classification Level Classification E-value
Superfamily Fibronectin type III 9.99e-21
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 14 Region: 10696-10793
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-20
Family I set domains 0.0099
Further Details:      
 
Domain Number 15 Region: 3383-3476
Classification Level Classification E-value
Superfamily Immunoglobulin 4.48e-20
Family I set domains 0.0096
Further Details:      
 
Domain Number 16 Region: 1257-1350
Classification Level Classification E-value
Superfamily Immunoglobulin 4.54e-20
Family I set domains 0.0054
Further Details:      
 
Domain Number 17 Region: 2234-2327
Classification Level Classification E-value
Superfamily Immunoglobulin 7.55e-20
Family I set domains 0.0026
Further Details:      
 
Domain Number 18 Region: 1661-1755
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-19
Family I set domains 0.029
Further Details:      
 
Domain Number 19 Region: 2591-2703
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 20 Region: 5916-6011
Classification Level Classification E-value
Superfamily Immunoglobulin 9.25e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 21 Region: 2711-2803
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-17
Family I set domains 0.0079
Further Details:      
 
Domain Number 22 Region: 10917-11011
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 23 Region: 10588-10687
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 24 Region: 3089-3214
Classification Level Classification E-value
Superfamily Immunoglobulin 5.74e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 25 Region: 10812-10906
Classification Level Classification E-value
Superfamily Immunoglobulin 6.56e-16
Family I set domains 0.0054
Further Details:      
 
Domain Number 26 Region: 2464-2577
Classification Level Classification E-value
Superfamily Immunoglobulin 7.61e-16
Family I set domains 0.0091
Further Details:      
 
Domain Number 27 Region: 2890-2988
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000473
Family I set domains 0.016
Further Details:      
 
Domain Number 28 Region: 4195-4290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000117
Family I set domains 0.0097
Further Details:      
 
Domain Number 29 Region: 1349-1444
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000045
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 30 Region: 1769-1864
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000235
Family I set domains 0.0054
Further Details:      
 
Domain Number 31 Region: 3028-3115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000262
Family I set domains 0.012
Further Details:      
 
Domain Number 32 Region: 4706-4801
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000467
Family I set domains 0.014
Further Details:      
 
Domain Number 33 Region: 5112-5207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000684
Family I set domains 0.014
Further Details:      
 
Domain Number 34 Region: 3480-3574
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000813
Family I set domains 0.0059
Further Details:      
 
Domain Number 35 Region: 9941-10044
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000004
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 36 Region: 9739-9823
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000692
Family I set domains 0.017
Further Details:      
 
Domain Number 37 Region: 3246-3330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000079
Family I set domains 0.014
Further Details:      
 
Domain Number 38 Region: 3645-3724
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000104
Family I set domains 0.017
Further Details:      
 
Domain Number 39 Region: 3912-3991
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000104
Family I set domains 0.017
Further Details:      
 
Domain Number 40 Region: 1121-1220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000113
Family I set domains 0.0063
Further Details:      
 
Domain Number 41 Region: 9006-9193
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000169
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 42 Region: 4043-4122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000926
Family I set domains 0.049
Further Details:      
 
Domain Number 43 Region: 3776-3855
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000976
Family I set domains 0.047
Further Details:      
 
Domain Number 44 Region: 8586-8695
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000137
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 45 Region: 5384-5497
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000213
Family I set domains 0.022
Further Details:      
 
Domain Number 46 Region: 5503-5608
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000283
Family I set domains 0.017
Further Details:      
 
Domain Number 47 Region: 4977-5091
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000528
Family I set domains 0.031
Further Details:      
 
Domain Number 48 Region: 4493-4588
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000879
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 49 Region: 11052-11127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000895
Family I set domains 0.033
Further Details:      
 
Domain Number 50 Region: 9245-9415
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000114
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 51 Region: 10458-10564
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000002
Family I set domains 0.027
Further Details:      
 
Domain Number 52 Region: 51-141
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000209
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 53 Region: 9485-9654
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000338
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 54 Region: 6051-6154
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000052
Family I set domains 0.018
Further Details:      
 
Domain Number 55 Region: 4599-4681
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000831
Family I set domains 0.046
Further Details:      
 
Domain Number 56 Region: 6453-6507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000436
Family I set domains 0.073
Further Details:      
 
Domain Number 57 Region: 8328-8528
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000651
Family Fibronectin type III 0.0068
Further Details:      
 
Domain Number 58 Region: 7677-7736
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000509
Family Fibronectin type III 0.0045
Further Details:      
 
Weak hits

Sequence:  EmuJ_000610500.1
Domain Number - Region: 7384-7538
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000184
Family Fibronectin type III 0.0069
Further Details:      
 
Domain Number - Region: 8210-8254
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000779
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number - Region: 9887-9968
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0011
Family I set domains 0.026
Further Details:      
 
Domain Number - Region: 119-189
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00288
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number - Region: 232-341,415-442
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00432
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 684-795
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0119
Family Spectrin repeat 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000610500.1
Sequence length 11194
Sequence
MSDREDSSTQSSSDFSDSFPSTTTISTVAVQAGQSKIILAIMRCGTWIKVRIQRMEPDLY
DIGSSGTSAEVRHLLEQHASLVSKLAAKQEQISELLTRAEEMVSQQPTEGQARVYSAISS
SLNKAWRELLDVLGKRGRLLQLVAECFEDAETVHAAVTRIIGASASNEWGDSMESVQRLI
QEHEELKSEELLEPTRRMLEVANGALELLTRMAVRTGQTPESGLTRTNAETRERIAAVTG
DANEAHRLAEAAWERRARLLQLRFTVVRLESEHEKVVEWFSKVGEPNLAAALPGGSLQNC
EAAMEALMGLAVDAREYQHINTRLIRQAQQLTLPRSEDEEEHDLEMRTAHKALVDRFATS
ENYIWEFIDRIESRRRCLQASIIFFSEASVLLNHLMTLEKDINFASTSRQEVCDEILQRL
TELEMRVSGLREILADLRSRVDERPSVIALSLTPVAPSRPISPLTSTADLAMSAKLNEIE
ETIVRCHRLCSGFPSRDIKDQQFKEIDYRLTALWRWTQERIDGVLRTHQSPGTTISSVSD
FEDLHRHLERQMAYQDREISTLSTLILSLPPSSEKQNFQHRLDEITKAWAHHRRTITIRL
RIADDLNRLLRRIREDEYYYQVLNDRLKSVAIETPLALSGVDLRVGQELREGEMSNIQAD
LLKVRSRLESQQRTLQYALDELSGVNATEADKVELQNFYRSQIQLNLERLHHLEGQLNSL
HSTRQIWLSWDEKWNDFRNSARQLDEAMTSSRTRIVQAPRPQSVSAVEAALAEHTRDGDY
VNQLIAEVNAKANTLASLVGAEPTATDGPSRVRRYVEVPYTTPGPSDAELAKSVRSELCI
ATAGLEIRSKDWERVFNAHKHTLEERAKQLSRMTEMDKVERDLRDAESEFQRISITVNLD
SPITQIERADENLRILELRIPDLQSRVRSTAYLPSMQFIRGPSDLLEISGVDVPMLEERQ
RQLETRVSNLVTGTAKCRTEVNLTLQLLCAVRDAENRLSSLTMDLGRSSDHLKSLAPDDQ
VQMRQIVAEIETQRDRAQKYADQHVPRLQTLAAQFPDDRARIKVQPIIRRFQDSTEALSK
LVQDVRVRSERLVDLTRLQGPVVEAVESVASHQMHLPRPKPPTILRPLSNIHVVEGTRVA
LTTNFDAGIPQGYPEIVDIEGTWHRDGLPVTTSDYRTRMDRHSASLTIEEVFEDDSGVFT
FRLKTPFGEVETSGSLMVSETHKSISSADEEMITPTKRRKPQQAPPTFPPFEEETGEAPR
FTRPLRSMEVGEDEPVMLECQAIGNPVPTIAWFKDGISIDNSPEYVVFEVNGSCAIKVRK
TNASIHDGNYTCRARNDHGEAITTCQLHVKPIEPPCIVYPLSDKQVPEGQSLELKLTFKG
TPPVRAEWYVNGVPLESTQSSAIPNIFGDKAILKLPATYQQDVAQYTCLLRNPAGEAKSS
CQVDLRSRRVERPLNIEDLVDAASVQPARRPLPQSPLQDGKQSPIASSPRLKTAPARPES
FDQGKVSPRSVYSPVSVEARPPWRATSVPPQFSSIYRTEHRRDLLAPKRTFSPSLLPPHF
TQPLHNAAATEGQMVRLQCRVLGRPKPQIDWYKDGVSLTSAPNYTVRSEGDRHCIEFSDI
YLTDHGEYTCVATNPAGVAKTSCRMDVEPLSSGDESVDRSPQIVKSLPRYLTINEGEGVT
LECSFVGRPEPSITWYKDTVPLQASPNVEIFQVGSTAVLNMTDSSIQDAGVYRAVASNRV
GGCQSEIHVNILPADKGPRPMDASPFHEVPPRFTKPLRDIYMETRSPRLSRLDCFVLGIP
RPTVEWRHANQRIGPEDRRYHITADRPPGVHTLTIVQPSQDTAGHYEVLAENIHGRATCS
ATVHLPRKWPLSSLSPHSPVVYTTLPRQTSPWRQVSPAASVHVIPTYATATTRRFLREVS
EPPELRRYTSTTQLHVNERHTTPPVQFTFRLPPERAMSKVEVLRPTESVPSPRLQIRHAS
SLTVLNKMRVCPTVPLQETTVQHHVASHPRLSPGYVSTEHLMRPIEVVPIVPVYETRQVL
EPLQLKPLRRTVSQDRFKVLVEAPISARPVLESNMATEVVHHKTIQVTPIVPIYRTQREA
SVASQPALEPGYTSEGEFEHNISVVPMIPSFKTETERSMPARPSLETGFESKTSLERQME
VQRELTELHYKTQMERPVPAQPQLFPGYATTMDVEHSMDVVPLVQKPEERFQTSYSTDVS
VQYVPIDLVVELPTPPKFVKHLNNVVAEEGSQVILEGVVSGKPTPAISWFRKSTPLTDSP
DFRLEYRPDGTVRLTLREICEEDIGPYRCAASNIAGTAESYAYLTITAKAVAPRFIKPLE
NTTVLSGNVIRLTVKVDGHPKPDVKWTVNGREITSSPDFVIEEVADGVQSLTIPHVLKTD
TGRYSVIAKNEAGEAITSGIVTVLESWPPSTMPSPKPAGDEMTRTEVTVPLALLTPGATI
APTPEAPKFAKMLPQCRVVEEETPIVLTVEAKANPMPFLHWYRNGIPLGTGPNYKISQFG
PYLENVNAIQPEPVRMVGELEVLRAAPTDAGSIVCVAENPHGRSETTMTLDVIPKPESLQ
PVVQPPRQAIPQKPWFTIPLQPDLTLQAGSPLTLTAEAMGNPLPFLHWYRDGQRLDSTPE
HDITQVGPELAKPGDLLDSPVSMTGRLVINELFPPDSGTYQCVAENSAGQAETFVTLNVF
TPPVKKQGQRPQFVKRLTPTVQCRVGETVVLETEISGQPPPRVSWYRSGIEIYPDFKYRM
EENPGTGIYRLVIQSIEQEDICEYTVRASNEYGSVESITRLTLIQEYTEVTRIDLPGTLA
PVTVEVPYAPAERTQLDVQVEGAFSPVVMAVEVTKPLQHLSELEMELRKSPMEFQPIIVE
FPHPDRSGQPAVFIRRLPDSLTLDENVPARITGQMSGIPLPSVSWLKDGQPLVSSNRVFT
SVEPNNTLVLHFAQPRPIDAGTYTAIITNPLGHDSSSVQVNLGALPEPKHDEPMLELMGV
PPSFTKAPFPLPSLVKGQADVIQSPGIFSSLEGTPLRFEVQVHGVPEPNVSWFLNEHPVH
CDFKHKILTLPESVHCLTLEAPTSLTDGGTYRCVASNPLGVKELVFPVTIEPKPQQVTVP
PRFLKKPASKIVTVPGQPLLLEAAFEGVPAPVISWHKDGRLISPTEVSSGHIQVLVTENS
TQLSVAEIKPEDVGTWQCLASSTAGSATCRTKLDLEVPKPVIEEPQKVLFIPKKRTSVSG
PSDSPYPEIRQSPKSLDVVEGNSARFSTMVVGTPRPLVCWYINGVLVQPTVPLEVSSEET
RESSHFDGLLHHLELRNCRPEDSGVVTVEALRADVSEDAARTEPNAVVTASANLRVLPAP
GKIPLLRPVQKIPTQQIKPSQPPVIIQGPKNAEVQEGSPITFACQVAGSPMPEVTWIYNG
QTAIQPLANFHPIVTPDGKASLRIDHVRPENAGEYKIRVTNQEGSVEKSARLDVTSGEKA
PDFTTPFPEEILKLPEGTSLTLDVEAVGKPTPQLVWKRDSTPFAPTPEIQITQLTSTHHR
LEILELFQTDSSEFSVEAFNKLGKAVTKTKLIVLPAVKEQPPVFLTRPHEQLTAFETATA
QTISTSTVVEVAETMPEVEEEKPREAVEEQPMLETPSVQICELKFTKPLQPALTPNEERI
LELECEIQADLKPITVKWTHNGQELQRSERCQEVYVEEQGVARLTIREFSPKDVGEYTCV
VSGEVIEPETGMLRQAKTITTTTVAEFAEEIPVVEEAKPTEAVEAQPKVQLAELKFTKPL
QPALTPNEERVVEMECEIQADLKPVMVRWTHDDKELQRSARLEEVFVEAQGLAKLTIKDF
TTEDAGKYTCEVSGEVIEPESGDLPRARTISTSTVVEVAETMPEVEEEKPREAVEEQPML
ETPSVQICELKFTKPLQPALTPNEERILELECEIQADLKPITVKWTHNGQELQRSERCQE
VYVEEQGVARLTIREFSPKDVGEYTCVVSGEVIEPETGMLRQAKTITTTTVAEFAEEIPV
VEEAKPTEAVEAQPKVQLAELKFTKPLQPALTPNEERVVEMECEIQADLKPVMVRWTHDD
KELQRSARLEEVFVEAQGLVKLTIKDFTTEDAGKYTCEVSGEVIEPESGDLPRARTISTS
TVVEVAETMPEVEEEKPREAVEEQPMLETPSVQVCEKHVYEDNQKWKSSVSGSNSPVFVK
ELLPLNVIEGEEIYLSAVVRGKPQPMDVTWRHNGVILQVDNNDVVLFYIPERGLCELTIS
EAFVEDAGVYEIEALNEFGVAVSQTKVVVRALEELEEPVTKEIALKEATSVEEELNPEDV
TNPIKEVIEETSPLVKAKPFETELKLSTEGKPMQELLVEKDKLYEFTIGAKGKSKEKTEH
EEEKEVTEEERREGVAGPVEMGKDKVDGKRKKESQPEPTVTAVEKEEMKESRTDLEVADR
VDGKGAPEATPLHESVPKVPKESEEIEFPGKEFSEDVQALPESAMETTNLPATPVNLRAE
VTPKKAPILSQSVELTWDQLDAATPDKCIVEITPKGKEKWIEFKVAKPSGRKLILLTKDM
EEFTDYEFRITAQNKKGKSKPSEPSNPIQLGIPLEFVRELPDIVVTQPPTEDEQIIFECE
LSRPSREKVQWIKDGKPLPQKRPSHLKVSEDISSTVHRIVFDEVKDEDVGEYIIKAEDAV
SKGKLKKDAVALVAPTLRLSEKFEDTIVLKAGASTVVEVPFTASPKPSIKWTWKSPTEGA
PETSPRFKPDTAMAGLTSLPMSKVKREDAGDYTVVIANELGETSVTVHLIVLDKPSPPRN
PHVTENTGDRVVFHWDEPEFAGLEPGGAPLEYVVEMREATQRVNKPVSKTVELSTPVESL
SVDKSYIFAVAAKNTVGQSDFVETKPVSTKLQYGPPLSPVNVKATVNPEKAPVSDQSVEL
TWEMPAEAGPVPADVTTEFVVEMKPKDATRWQEVAKDLTESRVTLPTDNMKEFTDYEFRV
TAKNKAGTSKPSQPSNAIQLGIPLEFIRELPKIVVTEAPSREKPVVLECELSRKPKESVK
WLHNGKPLPSRLPKGVTVEEEKQSTTHRITFTELTEDDLGEYTVQVEKIASTGGVEMRVA
PTLRLSEKFEDTIVLKAGASTVVEVPFTASPKPSIKWTWKSPTEGAPETSPRFKPDTAMA
GLTSLPMSKVKREDAGDYTVVIANELGETSVTVHLIVLDKPSPPSNPHVTENTGDLVSLE
WDEPQFVGDRCGTVLEYIVEMRELPMRTAIRVAETFELSSTVEGLQIDKSYVFSVASRNS
IGQSEFVETKPVSTKLAFGAPSSPKNVRAKLTPEKGLPADQLVELSWVQPIEVPSTQESK
PQFLVEMKQEGTDRWVPVSLTAPITDTNIIVPLEMMAEGANYQFRVAAKNMAGISPFSTP
SPRFQKPFDVAFTKELTDVHLEELPNDALFECEVSKPGMTLLWFKNGVEIQPDYRFIYEI
VGEGPLANTVHRLKVLDVGPGDQGVYTAQLINGLTSTSQLTAHSPPKINYEGRKLLTIAS
EKSAIVEVPFSGAPPPKVNWSFNGGKLPLGKNVDKPMASIQTVYGLTSLQLRRVDHTVEG
CYLVQVSNEFGKACLELKLQVLDVPRPVENLRAEMIKGEPMSVMVTWEPPKKDGGMPITD
YILEKREGSKRTWTPVGNPSMEISRRVTDLKPGQSYFFRVLAQNANGWSDPAEMDLPLRI
KAASNPPNTPNAPKVEDVTSTSCKLTIEPPTFDGGAPITFYHLEKRANRKENWVRATNNK
LPVSDPAKPYTVSLTDLIPDNVYEFRVAVENADALTSDFSIPSSRIATKPPFNAPGRPSK
PEVTIATEDSATITWNPPHDDGGDKVKRYVVQYKATDGTHWATCEEEPIDCLMTITKLQP
NSEYEFRVAAVNSVGAGEFSHPSQPYTPEKAIESAKPSILHPLENVTISVSTPLELECDF
KLGEPRAKIAWFKDDKPVRKFITSSPTERHATLKTSRAQLEDAGIFTCRAENAAGSISTT
CRVTVIQKPSVKLEHPRGSSEKVTGRISDGKLTGSAQGRLVVEALCEAVPACEELMWLHN
GQPLEETPRRLIERGLGDVHPKERPISPMRTRERLVINALEHSDTGVYRVEAKGPAGRAD
AAFTLVVIDKPQPPASINVMKTRETDSCFIQWHRPISDGGSKLKQYVVESLTVATDKTEA
APMLDTNWTTIGKTLPSELEFKARNLKPGILYAFRVSAENEVGRSEPIEIDTPIVLQSQL
QLPCEPINVVATRGGDREATVKWEPPESLDKRDLIGYVVEARESSDIKSSPPNRWIRVGP
STVRDATKLRLTDLNPSTDIQFRVLTRTHAGLSEPSEPTEWLIKPESKASYERTSPTQVH
KVDGSSKDITYVTSEDRRPKDIVEQVREFREAIKPKAPSTNEPPKIEITADKLFKCREGT
NLRVPLSVKSPVQASLELELKSGRPLSNEASLRSLVEQYGDSYYVNLKNLALTDTGHYRI
KATNAVGSSHAPFELVVIAPPQTPRGPIEVREIKLAKGIYDGSTVEVSWKVPALREGETL
ETAVIGYVFERKDGKRKDFGRPIKVQGPNTCTAVVEDLQPGVEYGFKVCAFNSTGMSEPL
YSGPVTIKSPFDVPGTCKGQLKCTDKSATSLVLNWQPPEKDGGLPIKKYHIERNEVGSFD
GWQPLAIVMAPTTSCPVSDLREGIPYRFRVRAVNDQGNGEWLNTESSISLNRPIGPPSEP
EKPLRVTPVDDTSANLSWKSPHDDGGSPVTGYIVEASRKGTDQWENLGVIKDTAFKATKL
IPDDTYTFRVSALNEAGKTGEPLYSVPYRPSAPPTAPGKPTAPIISHPLEAGQMVLDWGP
SPFGGTSGYGPPSEYRIERWEPMKDRWVHVARKPATEGTTVLVTGLRPGESYKFRVFAEN
TAGISEPLEMDKPVLAVSPYSPPSAPVGPMHISEVQKGESAADGSARLSWQEPTDDGGIP
LTGYIVQMRYANTTAWHKVVHLHEPTVDEDTDVILPTTTPVTGLKRSNGYYFRVAAINRA
GTGPFLESELFEMPEDESCRPKAEWIRVVGKGSDSVTVEWLVPHDCRKDHGPHIPHHLAL
DGFRVYIKAAEIPDAEWKAVADLDHYMNRLVVGGLSPDKRYYFGVAAVNQLGPGEIVSTA
EPVSPEAVTTVPGQPIGPLVVSDITQDSCVLSWKAPYSDGGTPITGYTIFKREMFRRSNQ
EVGRIPVVPGSLQRAFEFKVPYLMEGTSYEFQVVAENKNGFSEPLVTAADVHPRKMTEPP
GAPRGPLYVRDHDIGQVELAWGPPVNTGDLPIKGYKLELREGRSFTWRTYPNEESMVSNQ
PEELANPSVVVSGIKPNKEYFFRVSAINSDGCGPPLTAADSYVRRARLEPPKRVTAKLAS
PSESGPGKVDVTWISPDVPTLSGFTVEMMDTEDVRSEWVPMDFIPKMPNESGNTAYTYRA
TAPRPKSVYKFRVNAVYPESKSDWIETDFVLASEPTKESRIPPPITEAKFVPSTATPGGK
IPATLRWETPASGDVDSIRGYTVESWDIKHRTWKPVAHIPKEAPRELTFELPPARSTPLM
RITSMGDTTRSTPFEVPLERAKRIERTGEIPGDWKPLPSVTGPIEPEYNADEELSMIRTG
AATPFVSEFILQRRQAALDMIRRSTATPRSAGLDTIPLERFFAETPLVETLDLPQILSTP
HPLDRLRVTDIGKTTATVEWPEITDQSGFTVERWRPTSGRWTRLAEVPPSETRYVVPLSE
LPRTAPSDDAPINVWVRVVPRDAEGRPSAPPFQLEKPITLPGGEFVPSSVWGVDISPVGG
LSTPGRPVDVSWRPPSFTGGLPLTGYKLVITNADTEEQKSVFVEPKTTTYRLEGLNPQHE
YRVSITAVNRIGESMTVTSTVPKPPTIEDHLRRPPAPTSVELVPVSGGSPESKSGLLSWR
PGSRIGASPTNSYVIEKWDSCSKQWVPFKKVGKEVTEITIPYLLNDVMYAFRVRAQNEAG
LSKPGVAKEYFSPGRPLEELLFPAEKAPPAPPRGPLAYEPLTSKQRFDLATEKAMKIMEF
HWEEPIMTDRFSIPRSYILEARRGGQQKWAMVGRRPIPEGSRWKVAFGPSPPTVMPMPDI
DMSLPTLPMLPPAEPRISWLPGEPKDYEYRLSSENEYGFSEPIYLRPSVIPDLSRLYSPI
KPFVKELVKPAEIEPPRGPISVVRLPSRPMSHRGLFAPDLQLGSKPLPDVLISWKPPLST
QNIRGYEITYRQPFRTTWIHLGMVDAENTSFRIPRTVLKELPEAIHLGISSVGDRHTRTT
PYLSPRLEDTILLPRSTEEEILPPGELATPISPAYVSARVKGRPSMGVTPSGEVEVSWTF
PEAGRQLKRPEGYIAFYRELGSQQWQEIDRFPVGRPKDTVVLRELPRGTAMFIGIAPLVS
GRIGQIVSTPDTILLPDREAKETPKPLFERKPLQIRPMSPGGIEVSWAPPATINDLLALS
PGKMPKYELQVRHLGERLWRPISRPQLSESLRRPLIGEQPVAFHLHDLHPGDRLELRLLA
YSDLGKKPVQVSAKQTYKFISPYDIPSAPRGPLMVERRPVLPSRLPTLSPLRKSAGDFDE
LLYRLSTFPGAPVTPKFHERRETPTDLVNLSWRPPDDTGGLPITHYLIEQRSYDHRGLPA
PWVPVMTVPAGQTSVQLQPDTRRFKAEPSLYRVRAVNVVGPGLPLEALEPITLTTRDKSP
VVGKESIQHLPEAPLGPLRAEILPDSMVRLNWGAPRRWLGYSPRQSEGVRTPVYPQKYII
EATLADDSSMPWLEVGKVPGSVTTVTVRMPSLGLFRPGSSIETPSSRPILYRVRAENEYG
YSAPLTTRVGPDFKLQASLSKLPKLPDVPVRARILEPLEEYEVGVPPSIELEWAPFTPPA
LIPGASDRTPSVDYSYQVEYRPAGDLGWRHLATLPLGHERYTFYPPVPSFRDLEQPKSEA
FQFRVGVRGPIGVGEFRDSNIVSWNYRIRTPRSVPFSNLEPILTARAPLDFELVRTKVDT
PREPYTTPTGSISLKWRVPSYDKISAPESYVVERWIPETGTWRTLSHKLEGHGHGICETT
IHSLPIDEPHFIRVSSVGHMGTSEPATLPYPIWIPVTAPTTRFAAPEPPRNLDVTPILRD
RPGFLLTWTPPEVPVSRRTTEIPTLPSGYFVEYRPVGGEWKLLADLPAWQTDLETTKVEL
GKSYDFRVMSKGRLESVPLTPSARRPSRSIYPETSPAAMSKPAVSGPHTLPKQLVPPPSI
SGLLDVIPTREGIQLSWEPPRELPSGYIIELRSLDDHRHVWRTVARIPSADRGLPISSFL
IRYLEADKSYRFRVIPYRDEIHGRPVESLVPYRVSLADELGFHLTQRPRTIPPPRGPVTI
EELPSGLFRLGWRPPAVDLRMPTPGPMTYVVEQRIPGRRQWVEIGRTPNLSYTIDLDTTS
QFRIKTLVGEPSNILRGAEYLVGSDDGPQSDWIRLEERILEATKTDMVRRLPRDSTVKVE
QIAIPKRLFARHVGPSSVLLEWEYPKLPDQPTGYLYLEKRLVPDSKTDFVQPLWEPIARI
PISNLKTSYEVSDLSPGHSYLFRLVGKYGGSRASLQQSEISLPKPIRTRGGDLRSTSLPK
DMEYLMIPRSFTATFNRTPSGGLRFTWLPPESLESQTSKIRYRIEVRSVHDRANAWRLLA
KDIKGTEYALDATELERSLFLHRPAKGIPKTDSTDWHFRIIATVDGVDSHPKLLSSPLSI
TTEGERKKLRFLNVDKNCDIKCVLGQTLVIVFEVEGSPKPSVSWLLNGVTIYPEIDSNYL
VVSKSPGIYELRINNINYIHEGIITCKARNFYEEIEQSCRIHIDAPIRFSRTVFLAGQSD
HRVTSGGNWNVRLPLDVPYHVTDRSHWVHRTWVECIWKPRSASPDIVLPAERRAVVKISD
CGRWLILDLPGVSVQDEGLYRVWIENEAGRDYFDLRLHVDDKPRAKLQPPNIFPQGHSHF
LLSWQPPSSTDDTITSTGYRIEYISDKQLDAEENWQLLGTTGINQTEVLIGSQLKIGERY
RFRVRLQNLLGLGPASEPSRFICMETTEDEAEDHTISRRRYSREPIRFSSRKFEDRYEII
EELAKSRHAYLYRIRDRETGEYRIAKIMDLGDLSYIPVSRSYTSLADFRASVYTPSTRIR
HEAEEDRRLRAERELKLLASTHHKNIAELRDVFVDAQRLIWVIGDMMPETLWDQIKNRIR
MTEFRAALIMKQILSLMESLHDRNVAFLGGVDPSDIFFTDKLRRDIVLGGVSEYHKLTED
KPVRLTFRSTIYVPPELYSSDRLSTNTRPQTEISRATDVWSAGALLYQMLTGDTEHRPSV
EALEKLNLSPELLDFSRKLLHPDPTLRPTIAEALRHPWITIEHKMTEDIISQSARRLEEA
TSNAYKRLLRKIDWSERLDEEDNDFVDEMEHEIRKRRRLTEYRKRRRMSLDEYDKERDYE
DDEGIAMNVFLRGRGRVPRIAVPMANADAYEGSDTVMKCVLAPPAGERLDLNDVTVEWSV
NGKVIDLDHPSLRMTEKYAAKFDRSTGEATLRVKNLSVYDAGTYVATFRGSFGITSESAN
LKIHRGTAQRPTSREIATSMASEIGAKILRPLVDHTVVAGESLKFRIRVGGIPRPKCTWT
RNGLSLDNDPTCRIQEELVSTSISRSNEIICTFEIRNMKLSDAGIYSVNAYNKNGSDSCS
ASVAVLPERTSGSSVPKFITGLSNTSTVTGGTATLEAEVEGFPEPQIRWFKDGRMVVVGG
HITTTATETNGMNRLTCRLVITGCQLEDTGAYVCAATSASGTAISEATVIVKGAFMSSTT
RRDSESRLSITRCHPPEFVQRLKSRVVTLGNSVRLSASVMATPPASITWEKDDIPLVTDS
ANSPYQTKNLNGNVELRIEKCTASELGKYTLIAYNSAGEARCSCQLEKAREEVFKVPCFV
RQLVDRYFISGQKAILEVIAEGHPIPEFKWEKDGLVIRQESDPRYIFSASATSGRATLTI
PVVERDDAGLYSCVAHNPVGRDRCSCLIYVDGGGVQQRKSTSSPSTSISDTDKRPPQPPK
VQPATTPGQIEVVTSLPAVLEINEGDELRLFCIVKSDVHLIPTWTKAGRTLTFDGRRRIT
RNLMGEMCLTIDQAMTTDAGRYTLTVAPSDATLAETMKPVVLNTRVEVNPKIRSRTRISS
QMETQERSRSTRSWSRRESSYTYSRSSRERSFLR
Download sequence
Identical sequences EmuJ_000610500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]