SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000670400.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000670400.1
Domain Number 1 Region: 240-513
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.95e-55
Family Protein kinases, catalytic subunit 0.0000257
Further Details:      
 
Domain Number 2 Region: 108-227
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-17
Family SH2 domain 0.0013
Further Details:      
 
Domain Number 3 Region: 59-128
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000016
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000670400.1
Sequence length 527
Sequence
MVYGSMGHFLRKFKRKKGIDRVAEDGYVPPKPAYLWQRRRRQEERMDNEKKEQVTQTKIN
PWFQLCSSLQNQTAMALFSFPGDVQAGELEAWEGDPLKIESVDRTEVWWQAVNMRTGKSG
FIPWNYITEETGVKDVVGAWHEIDRRESEIKLTMPDLPNGTYVLRPSSNPLRIALSVLCI
VGSAKIIKHFSVRYDSSLSGYFITPGKRFTQLKDLTDYYKVSHGGKVPLLSSSMPHSPPP
IQSRNLRIPLEKLELKTHIARGGRFGSVYKAVCTTSGKRSVVVKKISGHMGRGAVVARAE
ACHKLHNRAIVQFIGLCEAPKSGLMLLVWEYMPGGNLRDFLIKNKTTTDYIRLQHWLHQI
LDGMDYLEGVEAFHGELTASNVFLSSELCAKIGNFGFNGRFSKFISDAFDLAETQAVRWA
APESLDSSHVFDIRCDIWSFGVVMFEVFTLGSTPYKDMDVEEVVERVKAGYRLPNPTSLG
FYCEEVMYETMKNCWNTDSTGRPTFHELWFVFEDHLAKDGDVYAEIE
Download sequence
Identical sequences A0A068Y3T2
EmuJ_000670400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]