SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EmuJ_000747200.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000747200.1
Domain Number 1 Region: 529-565,612-747
Classification Level Classification E-value
Superfamily SPOC domain-like 1.84e-26
Family SPOC domain 0.00088
Further Details:      
 
Domain Number 2 Region: 265-417
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.82e-23
Family Canonical RBD 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000747200.1
Sequence length 755
Sequence
MKRIARRDSPPHKRYRRDPGSNGRDSSSYRGYGNVGNRSRPMQPSPVYERRNPRPGSSSF
SRSPREYGDSGRQTGSGSYHSGPPIRRFPHRSSGSSGNMRSSDVYSQGSSHSDRFLQGLV
PGGELVGPSGTKIDPVFAAAAAAALNATLAAPSVSSSNVYSPNSSATVAAVAAAAMNAAA
IAAALGGASNQPNGGAGSNFQLPGIPSQSSLKRSSRSPTYERRGGGYRGERIRERDSPNY
RNEMPRRTSSSLGGGHPSPEDDPSATRTLFVGNLPPDIRISELRQIFDVYGILEDVDIKR
PQSSNSNEPAYAFLKYVNVSMAYRAKLGMTGKRIAGYVCKIGYGKVTPTRCLWVGGLGPW
TNYPMFASLVERFSRPKKIVWPSGKGYANILYHSTEAAAAAANLLRGYPLGTGNHRLRVD
FTDESHMLISGTIDSLRRGRPSGSGANDRTYRPRRESNRHPRSVSRSPVRPPSRRSSSSN
TSSATKSATPCPSSRSRSRSPSPTVAVPEDISLETACSIEEVAACLAGPIWKAVFVLKKS
NFSCRLHAVSGDSALADHLFPRQQPKPPQTPPDDEDDNGGGAVGAVVGEGEEKRPAGSPE
NNNNSCAVEPPLLRISQRMKMDPAKLEDVRKRMKSVGSGGYCVLLATEAANETVPAAGAE
NHSRPLRDLINYLASKEAAGVVLMGNDQEHQQQQQGVEDQHRIDSEPSGVLHVLPPGEFA
VSLLVEGGASCLQQKRVEPGDKYLVILLLKNYGLV
Download sequence
Identical sequences A0A068Y557
EmuJ_000747200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]