SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000790700.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000790700.1
Domain Number 1 Region: 367-453
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000723
Family Ras-binding domain, RBD 0.0084
Further Details:      
 
Domain Number 2 Region: 500-611
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000438
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000790700.1
Sequence length 735
Sequence
MDSELTELDDWVGTLEELQLGLERKCPPTPSNRLPSSSSSKFSYSDPRHLARSPPNPPSS
WRVAQILDSPPGLPPQHDAPSPPSLAVPAEEGQDASASTANTLTQSIRASFNPLSCREAT
AENDLNCLLRQLEEVESTMKQLEQDDGGFTRRYSLASSSTTDPNTGCNPSPAPDAPEQVI
PPPLFPLTTNGHGHTNNAEQRSAETAVRRPALVPRSLPLRSPSPSNTDYELADEASVAFL
LTPSIVTSTKITHMGPHDGDLIDEAPPARDQRNEMQRYHSMEVAVPSNEAQSNRLSSFDS
TPVRRSSLTALRPPLPPPLSQSPLATSLATTCSSNEASFSDKSVSQVSEFPELSNTLSRV
VELADRLQLNKLVVRIFRPDRTTKAILIDQRMAAGEIASMLIEKNFLEPCVKLCLVEKVP
SLKVERVFEESDIVAECILAWPIKSQNMIFFESRDDHFGFIESPKDWLGETYADAHGFHS
SDSVQTMLENFTSSGLAEWHDFLYIRKPGEKTWTRRMCVLRNSGLYATKKNKKAFLSSDL
VRLLALDDKLHIYTTTGGWSRMRAPTPHGFALKTYAAQDFSSSHVFCFCAPDEKALKQWA
CRLRLAKYGISLLRDYQIAKERVSRCLSGDPQTQKTVAEIKQLTRQSSVEWTRSSSFQAL
QPPLPRPQAPGVNPNPVNQVTTARTITPLPLVQQCIIPRTPQSATTLRRPPDLLFRNGYV
KHHSTGAPSQHFYIR
Download sequence
Identical sequences A0A068Y717
EmuJ_000790700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]