SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000845000.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000845000.1
Domain Number 1 Region: 18-123
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000234
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.01
Further Details:      
 
Domain Number 2 Region: 167-268
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000772
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000845000.1
Sequence length 331
Sequence
MITSALMTPDEKRYFENLVSYNSRVKVSCVARLYKAAYQSWVLISSGVVTLEELFVLNVV
SICFYGKKEGRKLIKTDLYKEMKYQQCTPQFHLFHGVVCPLGLAFACPKEANDLFAFVQT
KINPPSAQNGRFAALMYKAKRGIHGVAERVAGRLRNEDQTNIKFDQSGFKHIEHVGMDSN
GKGLRIKAQTKELAKELLEVLGVKAQSEIEMAAVINLIENCGVTEVQEALEIHNYTELEK
STRSTPAVTSPPAPPPPPLPSQQPANDDRGKLLNSIEGFDVTKLRQVKRTDEPESLPNKG
PIAMASIQTALAQMLNDRRKYLGGCDSDEDA
Download sequence
Identical sequences A0A068Y7U1
EmuJ_000845000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]