SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000849000.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000849000.1
Domain Number 1 Region: 28-261
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.78e-85
Family Calponin-homology domain, CH-domain 0.00000929
Further Details:      
 
Domain Number 2 Region: 281-402
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-32
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 3 Region: 895-1051
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-29
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 4 Region: 1537-1693
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-28
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 1004-1157
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-26
Family Spectrin repeat 0.0000425
Further Details:      
 
Domain Number 6 Region: 1214-1368
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-26
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 1856-2011
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-24
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 631-734
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-24
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 9 Region: 1432-1585
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-22
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 10 Region: 366-510
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-22
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 11 Region: 790-943
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-21
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 12 Region: 2155-2267
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-21
Family Pleckstrin-homology domain (PH domain) 0.00014
Further Details:      
 
Domain Number 13 Region: 1751-1874
Classification Level Classification E-value
Superfamily Spectrin repeat 1.65e-19
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 14 Region: 506-632
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-19
Family Spectrin repeat 0.00063
Further Details:      
 
Domain Number 15 Region: 2016-2077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000403
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000849000.1
Sequence length 2332
Sequence
MMMILKVAIVRQSYMSVLASRHSRVSLNAHTMSFLDEREIVQKKTFTKWVNSHLVVVNQK
IEDLYLDLRDGKHLLKLLEILSGERLPKPTRGKMRIHCLENVDKSLNFLCDQHVHLENVG
AHDIVDGNQRLTLGLIWTIILRFQIQDIIVEEYQTSETKCAKDALLLWCQMKTAGYNNVN
VRNFSTSWRDGLAFNALIHKHRPDLIEYQKLIKANPIQNLQNAFTVAHDKLGVPPLLEAS
DVCVEQPDEKSIITYVAAFYHCFNKMKADTVHSKRIGKVVNQALESSQLLDKYEQSTSDL
LNWIQKTIELLNDRVFANSLTDVQHQLAGFNTYRTVDKPPKFVEKGDLEVLLFTLQSKMR
ANNHKVYTPPEGKRIADINRAWENLEKAEHARELALRDELIRQEKLAQLATRFDRKAGMR
EAWLSENQRLVAQYNFGSDLATVEAATKKHEAIETDISAYAERVNAVVSVAEELQLENYY
DNDRIQMRRENVLHLWTNLLQLLRKRRSCLNLSLQLQRVFQEMAYLQDWIDEIGSRLKSE
DYGKHLMGVDDLLQKHKLLEADIHVLDDRLNQVLDQAKVFIDCNFPEIVEGYRPAEPEVV
QKRGEDLRAAYDELYRLANARRHGLEDSRKMWQFFWDMDDEKEWIKEKSQLMSSPDLGHD
LSSVERLLRKHLALEEECGIRQNVFYNAINVGNQLIEEDNRGKEDIRQRIDEMHKLWDQL
ADSTVDRKKRLLESQKFFQLIADCEDANAWLLDQQRIASNEDVGLKMSTTESLIKINQEL
MDNLEQYRESIKNLHDTSAEVSEYPDCDSAITSSHLNAVDENYAIAIEMAKQRQQRLLDA
LSMYKLFDVSDTVRTWITEKRKLLTTLCPSDEIEELGVIRHRFECFEKEMTKNAEKVGSV
NKLSENLIGTDHPDAQQIIIRQDTLNTTWNDLADLVEKQKGQLETAYQYNQFLIECQETA
NWIKEKEHLIESTDELGNDLEGIMQLQRRLSGLQRDLQAIQAKIDHLDEQADVLDAAKPE
ASEVIRAERKKIHDLWNELKEMLKERDDRLNDSSELQRFLQDLDHFQVWLRKAQVTVASE
DVPNTLPEAEKLLQDHEQFKPEIDGYEDDFMRLMAIGRKVVENQTDPLYLFLSERLDGIE
DNWVALHKMYEDRDKVLKRDVEAQSFFRDATLMDKLINKQEALITKDVASTPESVEEALR
NLNTFQAAMPANDEKISQVIAVGRNLANRGVFPVEKIVAKCDQLEQKRQAVKEKAIEREA
KLAQQSRLQGFVQDVDDVEEWISEKAILAQQAPPPCSGVGIAAIYGKFKTFESELDANKD
KIEKVIADGEQLMAEQPQLQAEIEPRMEVLRRQWVDLNNQAQEQSAKLADSNREALFDET
AKSMLTWITEVSSQIVTTTEEVTEEVGLVELNEQIKDQEKKEQELMAKRKMLDDMANHAE
KLKEQYPDRKDEFEQVHQEVRIRLMQLEAPMAKRRDRLLKQKRVRQFFRDLEDEKDWIRD
KLALIEDHGRMASSLLINQQLQRRHKMLTNEVDNHEPRVDAVCQQGEKMIAEGHPHSEKF
REGIDEVRALWATLRQALADRQAALAQNEIAQQYLFDASEAEAWMGEQELYLMGDEKAKD
EQGATNAMKKHELLQKTIENYASEIRSLGDRSRAMVESDHPESEVVAAKQSRVDKMYAGL
HDLCLERRLRLEEILKLYSLLREILDLEAWIDERTVIASSHEMGADYEHCCLLRERFADF
SKETNELGKHRVAAANELCDALIAQGHGEAAEIASWKDRVNEAWADLLELIETSIQLLKA
AWDLHKFLCDCQDVLDRIAEKAGAIPEDVGRDAKAVSVLQRKHAAFEAELSRLGQQVEEV
IDFANNLLPSYASEKESIICDRRDEVVQAWRQLQYAAEQRKIHLLDAGDVHRFLAMVREL
QLWMDTMRTEMTIKEKPRDVSGVELLMNNHKSLKAEIDAREENFSICLSLGRTLLNRRHP
REEEIRDKCIQLVTERVLLLEQWNDRNENLQLMLEVYHFARDAAIAEAWLVAQESFVKSP
DLGDSLDETLALLKKHLAFEKAVATQEERFIALQKETMLELKAKERTPESEAARKKAIDQ
KIAEASREFQPLPSTSQTAAALGSFHGTPLRRGVETPTGRSLRESVDSGRPAPHNLEAVL
YRKHEWETAAKRASGRSWHELYFVLNATLGTLSAYKDARSAHDKPGHLYHKEGPVSLAGA
VAAPATNYEKRPCVFRLKLLNGGESLFQCPSEDDMHNWVEAINSIAASLPAPVTVMPPTE
EEDVEGGLVAPAGRSATLPSTALHLSEPSTSDAQASGPLKPKKKFLTLMRKK
Download sequence
Identical sequences A0A068YF82
EmuJ_000849000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]