SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_000856100.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_000856100.1
Domain Number 1 Region: 22-260
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-74
Family Calponin-homology domain, CH-domain 0.0000407
Further Details:      
 
Domain Number 2 Region: 398-513
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-21
Family Spectrin repeat 0.0000906
Further Details:      
 
Domain Number 3 Region: 516-634
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-19
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 4 Region: 285-400
Classification Level Classification E-value
Superfamily Spectrin repeat 9.35e-19
Family Spectrin repeat 0.0000631
Further Details:      
 
Domain Number 5 Region: 741-882
Classification Level Classification E-value
Superfamily EF-hand 4.69e-18
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 6 Region: 641-748
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000072
Family Spectrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_000856100.1
Sequence length 958
Sequence
MSDEAWSLKAHQQKSIFEFEGYANDDDDEELPERETPIDPIWEKQQKKTFTAWCNLHLKK
KNAEITVIEEDFRNGLNLLLLLEAISGEQLSPPERGKLRVHKILNVNKALDFIQKKGVKL
VGIAAEEIVDGNVKMTLGMIWTIILRFAIQDIQIENCSANDGLLLWCQRSTEPYPEVNVK
NFNTSFKDGKAFCAIINRYRPDLLDFNDVAKAPARYALTKAFDVAEESLSIPKMLDVDDM
IESVKPDDRSVITYVSCFFHLFAEAEKTGAAATRIKKAVEISQMSDQLCDSYNRLFTDLK
TWIIKKKADFEHRKPVLNLEDVNKSIEGLRQYQTEEKPAKIEEKSRLETTFRTLQTRLRL
NNRPPYLPSDGMLIADILILWKELEICEKNYEEWLMGERKRTTTLAYWLSRFEVRCKTFE
AWASGKSDYLQSSDYTTCTVAEVRPMLKKHEAFVSDLMAQQDRVERIESIAQEIRNLGYT
DMPSIDSRCAQIKSSWDSLKALSDKRHQNLSDAQSVLEKIDAKHLEIAKLSAPFHNWMQQ
AEEDLLDKFIAQSTSDVEKLINTHAEYEKSSKEKAKEYEKIRDLEVEIEGLCKQINRESI
VNPYTNVTTSRLHEQWKTLQELTDQRRKELEEEKKHQLVCDQVRRRFIQLATELNGWLEQ
TQGRLNNVGLGEASLEEQVKLLTNLDGELEAQRPKLSELEDCHQHLQDAYGDLDFPVSMA
TLRSVWNQLSTGLKYTRNEIENQILTRDSKGLSKSQLDDLRRCFNHFDKDHTGRLECPEF
KACLVSVGHSIVAEAKKQRKTSVDTSDEDILKLMKQLDPNSNGSIAFDVFVDYMTRELTD
LDTSDQLLQSFRTISGEKGYLTEADLRRELPPEQVQYILSKLHPLTLRSHHIRHQVEPVF
PLLSLSRLIPIAANLSHRHLLTNHFFTIITIRSLVLISIPSFGNYTQLAAIPFFTHCF
Download sequence
Identical sequences A0A068Y8Y2
EmuJ_000856100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]