SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_001054000.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001054000.1
Domain Number 1 Region: 248-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000118
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 197-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 3 Region: 131-219
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000432
Family TB module/8-cys domain 0.0045
Further Details:      
 
Domain Number 4 Region: 345-419,474-520
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000126
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  EmuJ_001054000.1
Domain Number - Region: 108-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00016
Family EGF-type module 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001054000.1
Sequence length 535
Sequence
MQVTFGVRILLPLLVLFLSSPRLCDAYSSGRGPNVCGTFYGLTLCCKGWTKSLDGLCTTA
ICDGNCGERGSCIAPNQCRCEDGRVQDDCLMEDDNGYLADEPVRCPSNCNNQGRCINGKC
VCDFGFKGSACDEEEIGPCFIQTERGVCKNKVTDPGNKTAMMTQNACCGSIGVAWGGLCQ
RCSAQSSYCGKGYIRLNHHCVDINECEIPNVCMGGICRNTDGSFECDCPYGHVYDKNTVQ
CRPILDGCQKNPKACTPGGRCIPLHGTAYICQCDSGYVATDGNTRCRKEEVALNYCEIFE
GRLCKNGECHPTASSYDCTCNPGYVPSRFKKQCIKEFNACTFYGNSVCTNGQCVPVDRSF
RCICNPGYVLSGDGTACLDKCQQLGPSVCQNGFCVPRPYGDYECRCHYGYQPSPDRKSCL
MQLNPFQTSKREPLSSGNIYRGSYQADWPQENRVYHHVKPQLGETRWQPSSRVKYPNPCA
DSAVRRKCMGGFCINLGRGSYECRCYKGYRAVNGNQQCVADYGRTNRKYNWPTRG
Download sequence
Identical sequences A0A068YKN2
EmuJ_001054000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]