SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EmuJ_001096300.1 from Echinococcus multilocularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EmuJ_001096300.1
Domain Number 1 Region: 24-265
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.76e-88
Family Calponin-homology domain, CH-domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 282-404
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-28
Family Spectrin repeat 0.0000244
Further Details:      
 
Domain Number 3 Region: 517-639
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-22
Family Spectrin repeat 0.0000707
Further Details:      
 
Domain Number 4 Region: 349-512
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-18
Family Spectrin repeat 0.0000595
Further Details:      
 
Domain Number 5 Region: 757-899
Classification Level Classification E-value
Superfamily EF-hand 1.38e-16
Family EF-hand modules in multidomain proteins 0.03
Further Details:      
 
Domain Number 6 Region: 612-747
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000458
Family Spectrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EmuJ_001096300.1
Sequence length 974
Sequence
MSSNMEYYYNNTSAYYPNDAYYDTHIEPEEEEEWDRESYLDPMWEIQQKKTFTAWCNSYL
RKANTNITDIENDFRDGLKLLQLLETLAEEPLPKPDRGKMRFHMITNVNKALKYIESKGV
QLVSIGAEQIVDGNIKMTLGMIWTIILRFCIQDITVEELHAKEGLLLWCQRKTAPYSNVN
VQNFHTSWKDGLAFCALIHRHRPELIDYAKLSKENPIQNLNYAFDVAEKYLDIPKMLDAE
DMVNTIRPDERSVMTYVAAYYHAFANAHNTESAANKIAKVLKSNQDTEKLMQEYAALASD
LLKWINNQIPFLADRTTDGTLPHAKEKLAQYTAYGGSAKPPRVEDKALLEALNNTIQARL
KLAHKPAFMPPAGQSIGEINDAWREMEDMEKGYEDWLLNEIRRLEQLDYLVKKFKLKCST
HEAWSKDKEATLSTRDYENASYAELTAMAQKQNAFETDLGTHQNRVERIVSIAEELNALQ
YEDVISVNKRTQDIVSQWDRLGEISARRKEEIDKRLEVLKKIDNLQQSFARRVGPFSNWL
EQTEEDLQDMFIADRVEEVSQLINGHEAFKRALPAAQEELNSMLREAGEINRLVEQHDLP
REVAVNPYTMITHETLHDRWGCVQKLVPERDSALESELAKQQRNEQLRVQFAMQANRLGP
WLERALDALFAAQSNPTTAPLEQQMGGFKRMEEELEKMKPIIMEAERCYQQLQENGVYTV
PQTQYTMDTLRLGWEQFLTNLKRAINEVEVQIMTREAHNISEAQLNDFRRCFNHFDRKRL
RRLDLSEFKACLVSLGFNIPNTPEGDADFRRILANVDPSGSGYITFDSFMRFMTQQASGS
ESAEQLIDSFRVLANEQPFVTAETIQRELPPEQAKYCLQNMKPYSGNGAVPGALDYSDFS
NKIFVDLRQSSCPIASSSFSFATQIEPPTSRFSPSPQTPSFLVLSFDHLKVIICFFFGRF
EFTYAMQAYCEGCY
Download sequence
Identical sequences A0A068YLZ7
EmuJ_001096300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]