SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15607551|ref|NP_214924.1| from Mycobacterium tuberculosis H37Rv

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15607551|ref|NP_214924.1|
Domain Number 1 Region: 131-402
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.34e-45
Family Protein kinases, catalytic subunit 0.00065
Further Details:      
 
Domain Number 2 Region: 510-685
Classification Level Classification E-value
Superfamily TPR-like 0.00000826
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15607551|ref|NP_214924.1|
Sequence length 750
Comment Serine/threonine-protein kinase PknG (protein kinase G) (STPK G) [Mycobacterium tuberculosis H37Rv]
Sequence
MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Download sequence
Identical sequences A0A045H3P4 A0A0H3L605 A0A0H3MAF8 A0A0K2HS30 A0A109SKG1 A0A197IZ13 A0A1A9T7G6 A5TZD6 I6Y7R3 M8CJ32 P65729 P9WI72 P9WI73
233413.Mb0418c 336982.TBFG_10415 410289.BCG_0449c 419947.MRA_0416 478434.TBMG_00411 561275.JTY_0419 83332.Rv0410c gi|197739191|ref|YP_002160505.1| gi|479313264|ref|YP_007853316.1| IPRv0410cPALZ MbR291 Rv0410c rv0410c gi|31791588|ref|NP_854081.1| gi|506924812|ref|YP_008005262.1| gi|224988796|ref|YP_002643483.1| gi|433625501|ref|YP_007259130.1| gi|15607551|ref|NP_214924.1| gi|148821606|ref|YP_001286360.1| gi|15607551|ref|NP_214924.1| gi|449062408|ref|YP_007429491.1| gi|479054349|ref|YP_007350155.1| gi|471336232|ref|YP_007608945.1| gi|253797333|ref|YP_003030334.1| gi|506924812|ref|YP_008005262.1| gi|385997180|ref|YP_005915478.1| gi|148660175|ref|YP_001281698.1| gi|392385126|ref|YP_005306755.1| gi|121636324|ref|YP_976547.1| gi|378770158|ref|YP_005169891.1| gi|392430825|ref|YP_006471869.1| NP_214924.1.84033 WP_003402100.1.100021 WP_003402100.1.100069 WP_003402100.1.100087 WP_003402100.1.10015 WP_003402100.1.100208 WP_003402100.1.100216 WP_003402100.1.10022 WP_003402100.1.100255 WP_003402100.1.100260 WP_003402100.1.100270 WP_003402100.1.100279 WP_003402100.1.100286 WP_003402100.1.100308 WP_003402100.1.100309 WP_003402100.1.100318 WP_003402100.1.100338 WP_003402100.1.10037 WP_003402100.1.100383 WP_003402100.1.100396 WP_003402100.1.1004 WP_003402100.1.100401 WP_003402100.1.100460 WP_003402100.1.100552 WP_003402100.1.100581 WP_003402100.1.100600 WP_003402100.1.100625 WP_003402100.1.10064 WP_003402100.1.100666 WP_003402100.1.100671 WP_003402100.1.100677 WP_003402100.1.100697 WP_003402100.1.100703 WP_003402100.1.100716 WP_003402100.1.100722 WP_003402100.1.100754 WP_003402100.1.100757 WP_003402100.1.100772 WP_003402100.1.1008 WP_003402100.1.100812 WP_003402100.1.100845 WP_003402100.1.100866 WP_003402100.1.10088 WP_003402100.1.100889 WP_003402100.1.10090 WP_003402100.1.100910 WP_003402100.1.100915 WP_003402100.1.100918 WP_003402100.1.100935 WP_003402100.1.100984 WP_003402100.1.100998 WP_003402100.1.101 WP_003402100.1.101025 WP_003402100.1.101028 WP_003402100.1.10104 WP_003402100.1.101048 WP_003402100.1.101054 WP_003402100.1.101075 WP_003402100.1.101143 WP_003402100.1.101146 WP_003402100.1.10116 WP_003402100.1.10117 WP_003402100.1.101209 WP_003402100.1.10125 WP_003402100.1.101290 WP_003402100.1.101323 WP_003402100.1.101324 WP_003402100.1.101350 WP_003402100.1.101367 WP_003402100.1.101398 WP_003402100.1.101403 WP_003402100.1.101421 WP_003402100.1.10144 WP_003402100.1.101442 WP_003402100.1.10145 WP_003402100.1.101452 WP_003402100.1.101456 WP_003402100.1.101481 WP_003402100.1.101493 WP_003402100.1.101496 WP_003402100.1.101525 WP_003402100.1.101533 WP_003402100.1.101535 WP_003402100.1.101553 WP_003402100.1.101558 WP_003402100.1.10156 WP_003402100.1.101573 WP_003402100.1.101576 WP_003402100.1.10159 WP_003402100.1.101592 WP_003402100.1.101604 WP_003402100.1.101607 WP_003402100.1.101622 WP_003402100.1.101644 WP_003402100.1.101659 WP_003402100.1.101671 WP_003402100.1.101687 WP_003402100.1.101698 WP_003402100.1.10170 WP_003402100.1.101713 WP_003402100.1.101722 WP_003402100.1.101733 WP_003402100.1.101743 WP_003402100.1.101753 WP_003402100.1.101754 WP_003402100.1.101764 WP_003402100.1.101773 WP_003402100.1.101795 WP_003402100.1.101797 WP_003402100.1.101798 WP_003402100.1.101802 WP_003402100.1.101826 WP_003402100.1.101836 WP_003402100.1.101858 WP_003402100.1.101859 WP_003402100.1.101862 WP_003402100.1.101888 WP_003402100.1.101894 WP_003402100.1.101899 WP_003402100.1.101923 WP_003402100.1.101925 WP_003402100.1.10193 WP_003402100.1.101996 WP_003402100.1.102 WP_003402100.1.102008 WP_003402100.1.102017 WP_003402100.1.102053 WP_003402100.1.102055 WP_003402100.1.102063 WP_003402100.1.102099 WP_003402100.1.10211 WP_003402100.1.102119 WP_003402100.1.102121 WP_003402100.1.102143 WP_003402100.1.10216 WP_003402100.1.10224 WP_003402100.1.10253 WP_003402100.1.10262 WP_003402100.1.10272 WP_003402100.1.10277 WP_003402100.1.1033 WP_003402100.1.10350 WP_003402100.1.10362 WP_003402100.1.10366 WP_003402100.1.10376 WP_003402100.1.10396 WP_003402100.1.10410 WP_003402100.1.10430 WP_003402100.1.1044 WP_003402100.1.10440 WP_003402100.1.10471 WP_003402100.1.10472 WP_003402100.1.10489 WP_003402100.1.105 WP_003402100.1.10518 WP_003402100.1.10523 WP_003402100.1.10545 WP_003402100.1.10594 WP_003402100.1.10603 WP_003402100.1.10606 WP_003402100.1.10615 WP_003402100.1.10623 WP_003402100.1.10635 WP_003402100.1.10643 WP_003402100.1.10648 WP_003402100.1.10662 WP_003402100.1.10709 WP_003402100.1.10735 WP_003402100.1.10740 WP_003402100.1.10756 WP_003402100.1.1078 WP_003402100.1.10791 WP_003402100.1.10799 WP_003402100.1.10825 WP_003402100.1.10848 WP_003402100.1.10863 WP_003402100.1.10879 WP_003402100.1.10912 WP_003402100.1.10916 WP_003402100.1.10923 WP_003402100.1.10927 WP_003402100.1.1095 WP_003402100.1.10956 WP_003402100.1.10958 WP_003402100.1.10962 WP_003402100.1.10980 WP_003402100.1.10981 WP_003402100.1.10993 WP_003402100.1.1100 WP_003402100.1.11040 WP_003402100.1.11061 WP_003402100.1.11070 WP_003402100.1.11141 WP_003402100.1.11171 WP_003402100.1.11175 WP_003402100.1.11176 WP_003402100.1.11222 WP_003402100.1.11236 WP_003402100.1.11329 WP_003402100.1.1133 WP_003402100.1.11342 WP_003402100.1.11373 WP_003402100.1.11376 WP_003402100.1.11390 WP_003402100.1.11402 WP_003402100.1.11481 WP_003402100.1.11487 WP_003402100.1.11514 WP_003402100.1.11587 WP_003402100.1.11589 WP_003402100.1.11596 WP_003402100.1.11604 WP_003402100.1.11610 WP_003402100.1.11697 WP_003402100.1.11707 WP_003402100.1.11752 WP_003402100.1.11758 WP_003402100.1.11761 WP_003402100.1.11775 WP_003402100.1.11804 WP_003402100.1.11822 WP_003402100.1.11826 WP_003402100.1.11856 WP_003402100.1.11898 WP_003402100.1.11906 WP_003402100.1.11939 WP_003402100.1.11960 WP_003402100.1.11961 WP_003402100.1.11972 WP_003402100.1.120 WP_003402100.1.12001 WP_003402100.1.12049 WP_003402100.1.12052 WP_003402100.1.12100 WP_003402100.1.12116 WP_003402100.1.12161 WP_003402100.1.12165 WP_003402100.1.12184 WP_003402100.1.12187 WP_003402100.1.12190 WP_003402100.1.12216 WP_003402100.1.12265 WP_003402100.1.12275 WP_003402100.1.12293 WP_003402100.1.12294 WP_003402100.1.123 WP_003402100.1.1231 WP_003402100.1.12314 WP_003402100.1.12327 WP_003402100.1.12338 WP_003402100.1.1236 WP_003402100.1.12371 WP_003402100.1.12372 WP_003402100.1.12389 WP_003402100.1.12406 WP_003402100.1.1241 WP_003402100.1.12421 WP_003402100.1.12464 WP_003402100.1.12479 WP_003402100.1.12519 WP_003402100.1.12523 WP_003402100.1.1255 WP_003402100.1.12550 WP_003402100.1.12551 WP_003402100.1.12563 WP_003402100.1.12611 WP_003402100.1.12669 WP_003402100.1.1267 WP_003402100.1.12672 WP_003402100.1.12692 WP_003402100.1.1271 WP_003402100.1.12710 WP_003402100.1.12768 WP_003402100.1.1279 WP_003402100.1.12794 WP_003402100.1.12804 WP_003402100.1.12821 WP_003402100.1.12841 WP_003402100.1.12854 WP_003402100.1.12871 WP_003402100.1.12901 WP_003402100.1.12941 WP_003402100.1.12947 WP_003402100.1.12957 WP_003402100.1.12972 WP_003402100.1.13028 WP_003402100.1.13043 WP_003402100.1.13086 WP_003402100.1.13087 WP_003402100.1.13096 WP_003402100.1.13163 WP_003402100.1.13175 WP_003402100.1.13183 WP_003402100.1.132 WP_003402100.1.13282 WP_003402100.1.13284 WP_003402100.1.13296 WP_003402100.1.13298 WP_003402100.1.13302 WP_003402100.1.13306 WP_003402100.1.13312 WP_003402100.1.13313 WP_003402100.1.13321 WP_003402100.1.13345 WP_003402100.1.13358 WP_003402100.1.13370 WP_003402100.1.13375 WP_003402100.1.1338 WP_003402100.1.13420 WP_003402100.1.13433 WP_003402100.1.13435 WP_003402100.1.13438 WP_003402100.1.13461 WP_003402100.1.13466 WP_003402100.1.13489 WP_003402100.1.13551 WP_003402100.1.13564 WP_003402100.1.13579 WP_003402100.1.13687 WP_003402100.1.13697 WP_003402100.1.13719 WP_003402100.1.13763 WP_003402100.1.1377 WP_003402100.1.13774 WP_003402100.1.13786 WP_003402100.1.13793 WP_003402100.1.13794 WP_003402100.1.13817 WP_003402100.1.13834 WP_003402100.1.13866 WP_003402100.1.13880 WP_003402100.1.13899 WP_003402100.1.13909 WP_003402100.1.13910 WP_003402100.1.13919 WP_003402100.1.13920 WP_003402100.1.13952 WP_003402100.1.13953 WP_003402100.1.13962 WP_003402100.1.1398 WP_003402100.1.13988 WP_003402100.1.14027 WP_003402100.1.14046 WP_003402100.1.14115 WP_003402100.1.1415 WP_003402100.1.14152 WP_003402100.1.14162 WP_003402100.1.14175 WP_003402100.1.14178 WP_003402100.1.14194 WP_003402100.1.14208 WP_003402100.1.14238 WP_003402100.1.14266 WP_003402100.1.14273 WP_003402100.1.14303 WP_003402100.1.14306 WP_003402100.1.14307 WP_003402100.1.14310 WP_003402100.1.14382 WP_003402100.1.14416 WP_003402100.1.14428 WP_003402100.1.14441 WP_003402100.1.14469 WP_003402100.1.14477 WP_003402100.1.14504 WP_003402100.1.14514 WP_003402100.1.1452 WP_003402100.1.14527 WP_003402100.1.1454 WP_003402100.1.14544 WP_003402100.1.14548 WP_003402100.1.14551 WP_003402100.1.14561 WP_003402100.1.14573 WP_003402100.1.1462 WP_003402100.1.14658 WP_003402100.1.14667 WP_003402100.1.14668 WP_003402100.1.14675 WP_003402100.1.14694 WP_003402100.1.14695 WP_003402100.1.14709 WP_003402100.1.14766 WP_003402100.1.14783 WP_003402100.1.14865 WP_003402100.1.14872 WP_003402100.1.14905 WP_003402100.1.14926 WP_003402100.1.14951 WP_003402100.1.14955 WP_003402100.1.15009 WP_003402100.1.15028 WP_003402100.1.15040 WP_003402100.1.15052 WP_003402100.1.15065 WP_003402100.1.15072 WP_003402100.1.15089 WP_003402100.1.1509 WP_003402100.1.15126 WP_003402100.1.15131 WP_003402100.1.15168 WP_003402100.1.15174 WP_003402100.1.15187 WP_003402100.1.15196 WP_003402100.1.15210 WP_003402100.1.15216 WP_003402100.1.15217 WP_003402100.1.1523 WP_003402100.1.15232 WP_003402100.1.15238 WP_003402100.1.15240 WP_003402100.1.15253 WP_003402100.1.1527 WP_003402100.1.15292 WP_003402100.1.15299 WP_003402100.1.15302 WP_003402100.1.15322 WP_003402100.1.1534 WP_003402100.1.15345 WP_003402100.1.15365 WP_003402100.1.15372 WP_003402100.1.15386 WP_003402100.1.15387 WP_003402100.1.15442 WP_003402100.1.15447 WP_003402100.1.15449 WP_003402100.1.15477 WP_003402100.1.15481 WP_003402100.1.15492 WP_003402100.1.15511 WP_003402100.1.15512 WP_003402100.1.15558 WP_003402100.1.15559 WP_003402100.1.15566 WP_003402100.1.15599 WP_003402100.1.1560 WP_003402100.1.15611 WP_003402100.1.1563 WP_003402100.1.15633 WP_003402100.1.15643 WP_003402100.1.15688 WP_003402100.1.15755 WP_003402100.1.15763 WP_003402100.1.15774 WP_003402100.1.1578 WP_003402100.1.15780 WP_003402100.1.15834 WP_003402100.1.15842 WP_003402100.1.15848 WP_003402100.1.15853 WP_003402100.1.15870 WP_003402100.1.15877 WP_003402100.1.15893 WP_003402100.1.15896 WP_003402100.1.15926 WP_003402100.1.15933 WP_003402100.1.15946 WP_003402100.1.15958 WP_003402100.1.15973 WP_003402100.1.15987 WP_003402100.1.15993 WP_003402100.1.16009 WP_003402100.1.16025 WP_003402100.1.16043 WP_003402100.1.16055 WP_003402100.1.16066 WP_003402100.1.16069 WP_003402100.1.16077 WP_003402100.1.16106 WP_003402100.1.16108 WP_003402100.1.16110 WP_003402100.1.16130 WP_003402100.1.16136 WP_003402100.1.16139 WP_003402100.1.16141 WP_003402100.1.16143 WP_003402100.1.1630 WP_003402100.1.16318 WP_003402100.1.1632 WP_003402100.1.16327 WP_003402100.1.16334 WP_003402100.1.16341 WP_003402100.1.16345 WP_003402100.1.16374 WP_003402100.1.16384 WP_003402100.1.16386 WP_003402100.1.164 WP_003402100.1.1642 WP_003402100.1.16424 WP_003402100.1.16431 WP_003402100.1.1644 WP_003402100.1.16442 WP_003402100.1.16448 WP_003402100.1.16451 WP_003402100.1.16476 WP_003402100.1.16480 WP_003402100.1.16494 WP_003402100.1.1652 WP_003402100.1.16549 WP_003402100.1.16560 WP_003402100.1.16598 WP_003402100.1.16619 WP_003402100.1.16620 WP_003402100.1.16622 WP_003402100.1.16637 WP_003402100.1.1669 WP_003402100.1.16707 WP_003402100.1.16724 WP_003402100.1.16731 WP_003402100.1.16743 WP_003402100.1.1683 WP_003402100.1.16837 WP_003402100.1.16852 WP_003402100.1.16937 WP_003402100.1.16940 WP_003402100.1.16959 WP_003402100.1.1697 WP_003402100.1.16973 WP_003402100.1.16977 WP_003402100.1.16987 WP_003402100.1.17005 WP_003402100.1.17006 WP_003402100.1.17010 WP_003402100.1.17015 WP_003402100.1.17019 WP_003402100.1.17039 WP_003402100.1.17041 WP_003402100.1.17052 WP_003402100.1.17057 WP_003402100.1.17062 WP_003402100.1.1707 WP_003402100.1.17094 WP_003402100.1.17130 WP_003402100.1.17138 WP_003402100.1.17147 WP_003402100.1.17167 WP_003402100.1.17224 WP_003402100.1.17251 WP_003402100.1.17288 WP_003402100.1.17304 WP_003402100.1.17314 WP_003402100.1.17345 WP_003402100.1.17381 WP_003402100.1.17391 WP_003402100.1.17412 WP_003402100.1.1743 WP_003402100.1.17440 WP_003402100.1.17466 WP_003402100.1.17477 WP_003402100.1.17483 WP_003402100.1.17505 WP_003402100.1.17527 WP_003402100.1.17535 WP_003402100.1.17540 WP_003402100.1.17553 WP_003402100.1.17558 WP_003402100.1.17599 WP_003402100.1.17635 WP_003402100.1.17655 WP_003402100.1.17679 WP_003402100.1.1768 WP_003402100.1.17687 WP_003402100.1.17700 WP_003402100.1.17710 WP_003402100.1.17713 WP_003402100.1.17722 WP_003402100.1.17746 WP_003402100.1.17788 WP_003402100.1.17798 WP_003402100.1.17816 WP_003402100.1.17821 WP_003402100.1.17830 WP_003402100.1.17868 WP_003402100.1.17878 WP_003402100.1.1795 WP_003402100.1.17955 WP_003402100.1.17973 WP_003402100.1.18013 WP_003402100.1.18033 WP_003402100.1.18057 WP_003402100.1.18065 WP_003402100.1.18070 WP_003402100.1.18116 WP_003402100.1.18120 WP_003402100.1.18126 WP_003402100.1.1817 WP_003402100.1.18170 WP_003402100.1.18206 WP_003402100.1.18216 WP_003402100.1.18240 WP_003402100.1.18257 WP_003402100.1.18297 WP_003402100.1.18306 WP_003402100.1.18364 WP_003402100.1.18399 WP_003402100.1.18411 WP_003402100.1.18444 WP_003402100.1.18448 WP_003402100.1.18467 WP_003402100.1.18476 WP_003402100.1.18522 WP_003402100.1.18580 WP_003402100.1.18582 WP_003402100.1.18587 WP_003402100.1.186 WP_003402100.1.18601 WP_003402100.1.18639 WP_003402100.1.18646 WP_003402100.1.18647 WP_003402100.1.18694 WP_003402100.1.18710 WP_003402100.1.18751 WP_003402100.1.18781 WP_003402100.1.18793 WP_003402100.1.18804 WP_003402100.1.18816 WP_003402100.1.18823 WP_003402100.1.18827 WP_003402100.1.18838 WP_003402100.1.18849 WP_003402100.1.18856 WP_003402100.1.18945 WP_003402100.1.1898 WP_003402100.1.19005 WP_003402100.1.19056 WP_003402100.1.19066 WP_003402100.1.19071 WP_003402100.1.19085 WP_003402100.1.19094 WP_003402100.1.19144 WP_003402100.1.19159 WP_003402100.1.19193 WP_003402100.1.19231 WP_003402100.1.19243 WP_003402100.1.19264 WP_003402100.1.19295 WP_003402100.1.19307 WP_003402100.1.19326 WP_003402100.1.1933 WP_003402100.1.19364 WP_003402100.1.19382 WP_003402100.1.19400 WP_003402100.1.19426 WP_003402100.1.19429 WP_003402100.1.19464 WP_003402100.1.19480 WP_003402100.1.19553 WP_003402100.1.19562 WP_003402100.1.19564 WP_003402100.1.19568 WP_003402100.1.19572 WP_003402100.1.19595 WP_003402100.1.19600 WP_003402100.1.1967 WP_003402100.1.19694 WP_003402100.1.1970 WP_003402100.1.19707 WP_003402100.1.19742 WP_003402100.1.19785 WP_003402100.1.19820 WP_003402100.1.19868 WP_003402100.1.19874 WP_003402100.1.19890 WP_003402100.1.19900 WP_003402100.1.19922 WP_003402100.1.19936 WP_003402100.1.19946 WP_003402100.1.19949 WP_003402100.1.19960 WP_003402100.1.19964 WP_003402100.1.20007 WP_003402100.1.20016 WP_003402100.1.2003 WP_003402100.1.20037 WP_003402100.1.20039 WP_003402100.1.20082 WP_003402100.1.20085 WP_003402100.1.20097 WP_003402100.1.20116 WP_003402100.1.20130 WP_003402100.1.20141 WP_003402100.1.20142 WP_003402100.1.20158 WP_003402100.1.20239 WP_003402100.1.20243 WP_003402100.1.20259 WP_003402100.1.20262 WP_003402100.1.20272 WP_003402100.1.20280 WP_003402100.1.20294 WP_003402100.1.20300 WP_003402100.1.20309 WP_003402100.1.20322 WP_003402100.1.2037 WP_003402100.1.20372 WP_003402100.1.20381 WP_003402100.1.204 WP_003402100.1.20427 WP_003402100.1.20432 WP_003402100.1.20457 WP_003402100.1.20459 WP_003402100.1.20460 WP_003402100.1.20542 WP_003402100.1.20578 WP_003402100.1.20608 WP_003402100.1.20624 WP_003402100.1.20628 WP_003402100.1.2066 WP_003402100.1.20707 WP_003402100.1.20722 WP_003402100.1.20729 WP_003402100.1.20751 WP_003402100.1.20776 WP_003402100.1.20843 WP_003402100.1.20850 WP_003402100.1.20868 WP_003402100.1.20876 WP_003402100.1.20897 WP_003402100.1.20898 WP_003402100.1.20911 WP_003402100.1.20916 WP_003402100.1.20921 WP_003402100.1.20926 WP_003402100.1.20927 WP_003402100.1.20951 WP_003402100.1.20970 WP_003402100.1.2104 WP_003402100.1.21070 WP_003402100.1.21127 WP_003402100.1.21135 WP_003402100.1.21173 WP_003402100.1.21187 WP_003402100.1.212 WP_003402100.1.2120 WP_003402100.1.21218 WP_003402100.1.21219 WP_003402100.1.2123 WP_003402100.1.21231 WP_003402100.1.21234 WP_003402100.1.2126 WP_003402100.1.21292 WP_003402100.1.21307 WP_003402100.1.2131 WP_003402100.1.21311 WP_003402100.1.21321 WP_003402100.1.21365 WP_003402100.1.2137 WP_003402100.1.21392 WP_003402100.1.21397 WP_003402100.1.21403 WP_003402100.1.21415 WP_003402100.1.21430 WP_003402100.1.21434 WP_003402100.1.21444 WP_003402100.1.21468 WP_003402100.1.21498 WP_003402100.1.21509 WP_003402100.1.21513 WP_003402100.1.21560 WP_003402100.1.21565 WP_003402100.1.21586 WP_003402100.1.21591 WP_003402100.1.21594 WP_003402100.1.21602 WP_003402100.1.21615 WP_003402100.1.21638 WP_003402100.1.21639 WP_003402100.1.21655 WP_003402100.1.2168 WP_003402100.1.2174 WP_003402100.1.21741 WP_003402100.1.21742 WP_003402100.1.21777 WP_003402100.1.21786 WP_003402100.1.21795 WP_003402100.1.218 WP_003402100.1.21826 WP_003402100.1.21829 WP_003402100.1.21840 WP_003402100.1.21843 WP_003402100.1.21872 WP_003402100.1.2188 WP_003402100.1.21882 WP_003402100.1.21906 WP_003402100.1.21912 WP_003402100.1.2194 WP_003402100.1.21941 WP_003402100.1.21956 WP_003402100.1.21958 WP_003402100.1.21960 WP_003402100.1.21971 WP_003402100.1.21973 WP_003402100.1.21983 WP_003402100.1.22003 WP_003402100.1.22013 WP_003402100.1.22025 WP_003402100.1.22036 WP_003402100.1.22075 WP_003402100.1.22092 WP_003402100.1.2212 WP_003402100.1.22127 WP_003402100.1.22140 WP_003402100.1.22233 WP_003402100.1.22255 WP_003402100.1.22277 WP_003402100.1.22348 WP_003402100.1.22356 WP_003402100.1.22366 WP_003402100.1.2238 WP_003402100.1.22380 WP_003402100.1.22437 WP_003402100.1.22438 WP_003402100.1.22490 WP_003402100.1.22511 WP_003402100.1.22524 WP_003402100.1.2253 WP_003402100.1.22585 WP_003402100.1.22606 WP_003402100.1.22608 WP_003402100.1.22609 WP_003402100.1.22618 WP_003402100.1.2262 WP_003402100.1.22624 WP_003402100.1.22629 WP_003402100.1.22647 WP_003402100.1.22664 WP_003402100.1.22665 WP_003402100.1.22670 WP_003402100.1.22680 WP_003402100.1.22725 WP_003402100.1.22728 WP_003402100.1.22733 WP_003402100.1.22737 WP_003402100.1.22754 WP_003402100.1.22800 WP_003402100.1.22804 WP_003402100.1.22829 WP_003402100.1.22840 WP_003402100.1.22844 WP_003402100.1.22970 WP_003402100.1.22996 WP_003402100.1.22997 WP_003402100.1.22999 WP_003402100.1.23015 WP_003402100.1.23032 WP_003402100.1.231 WP_003402100.1.23101 WP_003402100.1.2312 WP_003402100.1.23140 WP_003402100.1.23153 WP_003402100.1.23171 WP_003402100.1.23199 WP_003402100.1.2320 WP_003402100.1.23204 WP_003402100.1.23216 WP_003402100.1.23229 WP_003402100.1.23233 WP_003402100.1.2326 WP_003402100.1.23261 WP_003402100.1.23272 WP_003402100.1.23289 WP_003402100.1.2329 WP_003402100.1.23308 WP_003402100.1.23316 WP_003402100.1.23321 WP_003402100.1.23325 WP_003402100.1.2339 WP_003402100.1.23406 WP_003402100.1.23438 WP_003402100.1.23445 WP_003402100.1.23447 WP_003402100.1.23452 WP_003402100.1.23461 WP_003402100.1.2349 WP_003402100.1.23496 WP_003402100.1.23497 WP_003402100.1.23506 WP_003402100.1.23530 WP_003402100.1.23539 WP_003402100.1.23546 WP_003402100.1.23551 WP_003402100.1.23573 WP_003402100.1.23583 WP_003402100.1.23588 WP_003402100.1.23628 WP_003402100.1.23677 WP_003402100.1.23683 WP_003402100.1.23694 WP_003402100.1.23699 WP_003402100.1.2371 WP_003402100.1.23807 WP_003402100.1.23825 WP_003402100.1.23832 WP_003402100.1.2384 WP_003402100.1.23843 WP_003402100.1.23863 WP_003402100.1.2387 WP_003402100.1.23894 WP_003402100.1.23993 WP_003402100.1.2400 WP_003402100.1.24007 WP_003402100.1.24008 WP_003402100.1.24046 WP_003402100.1.24057 WP_003402100.1.24062 WP_003402100.1.24113 WP_003402100.1.24119 WP_003402100.1.24128 WP_003402100.1.24140 WP_003402100.1.24176 WP_003402100.1.24190 WP_003402100.1.24202 WP_003402100.1.24261 WP_003402100.1.24284 WP_003402100.1.24294 WP_003402100.1.24357 WP_003402100.1.24396 WP_003402100.1.24423 WP_003402100.1.2443 WP_003402100.1.24446 WP_003402100.1.24461 WP_003402100.1.24500 WP_003402100.1.24507 WP_003402100.1.24509 WP_003402100.1.24529 WP_003402100.1.24553 WP_003402100.1.24599 WP_003402100.1.24629 WP_003402100.1.24638 WP_003402100.1.24648 WP_003402100.1.2466 WP_003402100.1.24824 WP_003402100.1.24831 WP_003402100.1.24840 WP_003402100.1.24848 WP_003402100.1.24857 WP_003402100.1.2487 WP_003402100.1.24893 WP_003402100.1.24933 WP_003402100.1.24956 WP_003402100.1.24958 WP_003402100.1.24985 WP_003402100.1.2499 WP_003402100.1.25004 WP_003402100.1.2505 WP_003402100.1.25051 WP_003402100.1.2507 WP_003402100.1.25096 WP_003402100.1.25103 WP_003402100.1.25129 WP_003402100.1.25171 WP_003402100.1.25184 WP_003402100.1.25247 WP_003402100.1.25278 WP_003402100.1.25309 WP_003402100.1.25313 WP_003402100.1.25338 WP_003402100.1.25342 WP_003402100.1.25343 WP_003402100.1.25367 WP_003402100.1.25393 WP_003402100.1.25406 WP_003402100.1.25435 WP_003402100.1.25437 WP_003402100.1.25455 WP_003402100.1.25473 WP_003402100.1.25504 WP_003402100.1.25513 WP_003402100.1.25542 WP_003402100.1.25579 WP_003402100.1.25594 WP_003402100.1.25606 WP_003402100.1.25645 WP_003402100.1.2566 WP_003402100.1.25673 WP_003402100.1.25674 WP_003402100.1.25699 WP_003402100.1.25727 WP_003402100.1.25736 WP_003402100.1.25738 WP_003402100.1.25756 WP_003402100.1.25759 WP_003402100.1.2580 WP_003402100.1.25813 WP_003402100.1.25853 WP_003402100.1.25854 WP_003402100.1.25874 WP_003402100.1.25885 WP_003402100.1.25892 WP_003402100.1.25906 WP_003402100.1.25914 WP_003402100.1.25916 WP_003402100.1.2594 WP_003402100.1.25954 WP_003402100.1.25965 WP_003402100.1.25972 WP_003402100.1.26017 WP_003402100.1.26032 WP_003402100.1.26038 WP_003402100.1.26072 WP_003402100.1.26097 WP_003402100.1.26098 WP_003402100.1.26108 WP_003402100.1.26109 WP_003402100.1.26118 WP_003402100.1.2614 WP_003402100.1.26168 WP_003402100.1.26182 WP_003402100.1.26190 WP_003402100.1.2620 WP_003402100.1.26243 WP_003402100.1.26265 WP_003402100.1.26267 WP_003402100.1.26292 WP_003402100.1.26310 WP_003402100.1.26328 WP_003402100.1.26349 WP_003402100.1.26366 WP_003402100.1.26374 WP_003402100.1.26407 WP_003402100.1.26412 WP_003402100.1.26454 WP_003402100.1.26464 WP_003402100.1.2653 WP_003402100.1.26560 WP_003402100.1.26571 WP_003402100.1.2659 WP_003402100.1.26597 WP_003402100.1.26603 WP_003402100.1.26629 WP_003402100.1.26651 WP_003402100.1.26702 WP_003402100.1.26707 WP_003402100.1.26710 WP_003402100.1.26737 WP_003402100.1.26738 WP_003402100.1.26745 WP_003402100.1.26756 WP_003402100.1.2676 WP_003402100.1.2677 WP_003402100.1.26779 WP_003402100.1.26780 WP_003402100.1.26798 WP_003402100.1.26854 WP_003402100.1.26868 WP_003402100.1.26876 WP_003402100.1.26888 WP_003402100.1.26914 WP_003402100.1.26945 WP_003402100.1.26959 WP_003402100.1.26969 WP_003402100.1.26984 WP_003402100.1.26992 WP_003402100.1.27004 WP_003402100.1.27017 WP_003402100.1.27045 WP_003402100.1.27075 WP_003402100.1.27128 WP_003402100.1.27130 WP_003402100.1.27139 WP_003402100.1.27152 WP_003402100.1.27162 WP_003402100.1.27164 WP_003402100.1.27193 WP_003402100.1.27235 WP_003402100.1.27254 WP_003402100.1.27278 WP_003402100.1.27343 WP_003402100.1.27352 WP_003402100.1.27369 WP_003402100.1.27391 WP_003402100.1.27398 WP_003402100.1.27402 WP_003402100.1.27410 WP_003402100.1.27411 WP_003402100.1.27449 WP_003402100.1.27460 WP_003402100.1.27463 WP_003402100.1.2749 WP_003402100.1.27492 WP_003402100.1.27541 WP_003402100.1.27576 WP_003402100.1.27582 WP_003402100.1.27596 WP_003402100.1.27607 WP_003402100.1.2766 WP_003402100.1.277 WP_003402100.1.27724 WP_003402100.1.27730 WP_003402100.1.27736 WP_003402100.1.27750 WP_003402100.1.27771 WP_003402100.1.27779 WP_003402100.1.27795 WP_003402100.1.27819 WP_003402100.1.27835 WP_003402100.1.27915 WP_003402100.1.27935 WP_003402100.1.27962 WP_003402100.1.28053 WP_003402100.1.28092 WP_003402100.1.28106 WP_003402100.1.28131 WP_003402100.1.28142 WP_003402100.1.28159 WP_003402100.1.2816 WP_003402100.1.28161 WP_003402100.1.28192 WP_003402100.1.28202 WP_003402100.1.28241 WP_003402100.1.28242 WP_003402100.1.28251 WP_003402100.1.28255 WP_003402100.1.28269 WP_003402100.1.28276 WP_003402100.1.28293 WP_003402100.1.28331 WP_003402100.1.28367 WP_003402100.1.28378 WP_003402100.1.28391 WP_003402100.1.2842 WP_003402100.1.28448 WP_003402100.1.2847 WP_003402100.1.28471 WP_003402100.1.28473 WP_003402100.1.28493 WP_003402100.1.28497 WP_003402100.1.28530 WP_003402100.1.28545 WP_003402100.1.28561 WP_003402100.1.28567 WP_003402100.1.28585 WP_003402100.1.286 WP_003402100.1.28610 WP_003402100.1.28617 WP_003402100.1.28634 WP_003402100.1.28642 WP_003402100.1.28698 WP_003402100.1.28703 WP_003402100.1.28739 WP_003402100.1.28758 WP_003402100.1.28781 WP_003402100.1.28787 WP_003402100.1.28827 WP_003402100.1.28839 WP_003402100.1.28847 WP_003402100.1.28850 WP_003402100.1.28851 WP_003402100.1.28865 WP_003402100.1.28897 WP_003402100.1.28914 WP_003402100.1.28935 WP_003402100.1.28936 WP_003402100.1.28939 WP_003402100.1.28943 WP_003402100.1.28952 WP_003402100.1.28975 WP_003402100.1.2899 WP_003402100.1.28993 WP_003402100.1.29000 WP_003402100.1.2901 WP_003402100.1.29028 WP_003402100.1.29033 WP_003402100.1.29058 WP_003402100.1.29078 WP_003402100.1.29102 WP_003402100.1.29115 WP_003402100.1.2916 WP_003402100.1.29217 WP_003402100.1.29234 WP_003402100.1.29264 WP_003402100.1.29275 WP_003402100.1.29306 WP_003402100.1.29339 WP_003402100.1.29364 WP_003402100.1.29367 WP_003402100.1.29399 WP_003402100.1.29426 WP_003402100.1.2944 WP_003402100.1.29449 WP_003402100.1.29450 WP_003402100.1.29452 WP_003402100.1.2949 WP_003402100.1.29510 WP_003402100.1.29515 WP_003402100.1.29525 WP_003402100.1.2953 WP_003402100.1.29559 WP_003402100.1.29587 WP_003402100.1.2959 WP_003402100.1.29592 WP_003402100.1.29599 WP_003402100.1.29611 WP_003402100.1.29632 WP_003402100.1.29649 WP_003402100.1.2965 WP_003402100.1.29659 WP_003402100.1.2969 WP_003402100.1.29696 WP_003402100.1.29698 WP_003402100.1.29718 WP_003402100.1.29745 WP_003402100.1.29747 WP_003402100.1.29769 WP_003402100.1.29825 WP_003402100.1.29830 WP_003402100.1.29847 WP_003402100.1.29861 WP_003402100.1.29869 WP_003402100.1.29883 WP_003402100.1.29890 WP_003402100.1.29931 WP_003402100.1.30014 WP_003402100.1.3004 WP_003402100.1.30040 WP_003402100.1.30043 WP_003402100.1.30074 WP_003402100.1.30097 WP_003402100.1.30106 WP_003402100.1.30114 WP_003402100.1.30126 WP_003402100.1.30131 WP_003402100.1.30138 WP_003402100.1.30139 WP_003402100.1.30145 WP_003402100.1.30235 WP_003402100.1.30237 WP_003402100.1.3027 WP_003402100.1.30279 WP_003402100.1.30282 WP_003402100.1.30283 WP_003402100.1.30288 WP_003402100.1.30291 WP_003402100.1.30363 WP_003402100.1.30374 WP_003402100.1.30404 WP_003402100.1.3043 WP_003402100.1.30433 WP_003402100.1.30438 WP_003402100.1.30464 WP_003402100.1.30468 WP_003402100.1.30500 WP_003402100.1.3057 WP_003402100.1.30574 WP_003402100.1.30628 WP_003402100.1.30641 WP_003402100.1.30642 WP_003402100.1.30661 WP_003402100.1.30669 WP_003402100.1.30683 WP_003402100.1.30699 WP_003402100.1.30709 WP_003402100.1.30713 WP_003402100.1.30716 WP_003402100.1.30719 WP_003402100.1.30730 WP_003402100.1.30732 WP_003402100.1.30736 WP_003402100.1.30745 WP_003402100.1.30760 WP_003402100.1.30791 WP_003402100.1.308 WP_003402100.1.30807 WP_003402100.1.30818 WP_003402100.1.30824 WP_003402100.1.30848 WP_003402100.1.30877 WP_003402100.1.30888 WP_003402100.1.30901 WP_003402100.1.30903 WP_003402100.1.30913 WP_003402100.1.30914 WP_003402100.1.30919 WP_003402100.1.30977 WP_003402100.1.3100 WP_003402100.1.31002 WP_003402100.1.3101 WP_003402100.1.31034 WP_003402100.1.31047 WP_003402100.1.31070 WP_003402100.1.31074 WP_003402100.1.31102 WP_003402100.1.31127 WP_003402100.1.31184 WP_003402100.1.31199 WP_003402100.1.31226 WP_003402100.1.31230 WP_003402100.1.31233 WP_003402100.1.31263 WP_003402100.1.31264 WP_003402100.1.31270 WP_003402100.1.31287 WP_003402100.1.31290 WP_003402100.1.31304 WP_003402100.1.31346 WP_003402100.1.31348 WP_003402100.1.31354 WP_003402100.1.31390 WP_003402100.1.31414 WP_003402100.1.31417 WP_003402100.1.31428 WP_003402100.1.3143 WP_003402100.1.31458 WP_003402100.1.31483 WP_003402100.1.3149 WP_003402100.1.31498 WP_003402100.1.31507 WP_003402100.1.31537 WP_003402100.1.31548 WP_003402100.1.31569 WP_003402100.1.31573 WP_003402100.1.316 WP_003402100.1.31629 WP_003402100.1.31666 WP_003402100.1.31693 WP_003402100.1.31703 WP_003402100.1.31744 WP_003402100.1.31745 WP_003402100.1.31770 WP_003402100.1.31776 WP_003402100.1.31783 WP_003402100.1.318 WP_003402100.1.3184 WP_003402100.1.31840 WP_003402100.1.31880 WP_003402100.1.31911 WP_003402100.1.31930 WP_003402100.1.31932 WP_003402100.1.31955 WP_003402100.1.31985 WP_003402100.1.31991 WP_003402100.1.31995 WP_003402100.1.32004 WP_003402100.1.32039 WP_003402100.1.3204 WP_003402100.1.32045 WP_003402100.1.32071 WP_003402100.1.32098 WP_003402100.1.32157 WP_003402100.1.32164 WP_003402100.1.32179 WP_003402100.1.32198 WP_003402100.1.32297 WP_003402100.1.32317 WP_003402100.1.32383 WP_003402100.1.32400 WP_003402100.1.32403 WP_003402100.1.32416 WP_003402100.1.32433 WP_003402100.1.32461 WP_003402100.1.32482 WP_003402100.1.32503 WP_003402100.1.32556 WP_003402100.1.32562 WP_003402100.1.32569 WP_003402100.1.32592 WP_003402100.1.32620 WP_003402100.1.32647 WP_003402100.1.32653 WP_003402100.1.32654 WP_003402100.1.3268 WP_003402100.1.32695 WP_003402100.1.32706 WP_003402100.1.32716 WP_003402100.1.32738 WP_003402100.1.32752 WP_003402100.1.32781 WP_003402100.1.32793 WP_003402100.1.32799 WP_003402100.1.32822 WP_003402100.1.32833 WP_003402100.1.32862 WP_003402100.1.32880 WP_003402100.1.32897 WP_003402100.1.32909 WP_003402100.1.32935 WP_003402100.1.32974 WP_003402100.1.33007 WP_003402100.1.3302 WP_003402100.1.33028 WP_003402100.1.33044 WP_003402100.1.33054 WP_003402100.1.33082 WP_003402100.1.33141 WP_003402100.1.33148 WP_003402100.1.33155 WP_003402100.1.3321 WP_003402100.1.33215 WP_003402100.1.3325 WP_003402100.1.3327 WP_003402100.1.33278 WP_003402100.1.33288 WP_003402100.1.33305 WP_003402100.1.3331 WP_003402100.1.33319 WP_003402100.1.3333 WP_003402100.1.33393 WP_003402100.1.33403 WP_003402100.1.33452 WP_003402100.1.33467 WP_003402100.1.33477 WP_003402100.1.3349 WP_003402100.1.33519 WP_003402100.1.33542 WP_003402100.1.33601 WP_003402100.1.33602 WP_003402100.1.33633 WP_003402100.1.33646 WP_003402100.1.33673 WP_003402100.1.3369 WP_003402100.1.33705 WP_003402100.1.33762 WP_003402100.1.33783 WP_003402100.1.33789 WP_003402100.1.3383 WP_003402100.1.33832 WP_003402100.1.33839 WP_003402100.1.33848 WP_003402100.1.3387 WP_003402100.1.33886 WP_003402100.1.33895 WP_003402100.1.33912 WP_003402100.1.33954 WP_003402100.1.34042 WP_003402100.1.3405 WP_003402100.1.34055 WP_003402100.1.34056 WP_003402100.1.34065 WP_003402100.1.3408 WP_003402100.1.34090 WP_003402100.1.34109 WP_003402100.1.34111 WP_003402100.1.34152 WP_003402100.1.34163 WP_003402100.1.34181 WP_003402100.1.34197 WP_003402100.1.34198 WP_003402100.1.34215 WP_003402100.1.34219 WP_003402100.1.34255 WP_003402100.1.34260 WP_003402100.1.34275 WP_003402100.1.343 WP_003402100.1.34347 WP_003402100.1.34358 WP_003402100.1.34392 WP_003402100.1.344 WP_003402100.1.34428 WP_003402100.1.3443 WP_003402100.1.34435 WP_003402100.1.34499 WP_003402100.1.34505 WP_003402100.1.34516 WP_003402100.1.34529 WP_003402100.1.34551 WP_003402100.1.34563 WP_003402100.1.34576 WP_003402100.1.34581 WP_003402100.1.34588 WP_003402100.1.34596 WP_003402100.1.34599 WP_003402100.1.34639 WP_003402100.1.34673 WP_003402100.1.34724 WP_003402100.1.34740 WP_003402100.1.34755 WP_003402100.1.34777 WP_003402100.1.34783 WP_003402100.1.34841 WP_003402100.1.34908 WP_003402100.1.34919 WP_003402100.1.3492 WP_003402100.1.34933 WP_003402100.1.34945 WP_003402100.1.34946 WP_003402100.1.34954 WP_003402100.1.34960 WP_003402100.1.34961 WP_003402100.1.34963 WP_003402100.1.34965 WP_003402100.1.34968 WP_003402100.1.35023 WP_003402100.1.35069 WP_003402100.1.35072 WP_003402100.1.35078 WP_003402100.1.35156 WP_003402100.1.35160 WP_003402100.1.35162 WP_003402100.1.35173 WP_003402100.1.35176 WP_003402100.1.3520 WP_003402100.1.35221 WP_003402100.1.35246 WP_003402100.1.35278 WP_003402100.1.35301 WP_003402100.1.35311 WP_003402100.1.35312 WP_003402100.1.35317 WP_003402100.1.35319 WP_003402100.1.35347 WP_003402100.1.35363 WP_003402100.1.35382 WP_003402100.1.35385 WP_003402100.1.35396 WP_003402100.1.35397 WP_003402100.1.35426 WP_003402100.1.35439 WP_003402100.1.35455 WP_003402100.1.3548 WP_003402100.1.35484 WP_003402100.1.35492 WP_003402100.1.3553 WP_003402100.1.35553 WP_003402100.1.35555 WP_003402100.1.35561 WP_003402100.1.35610 WP_003402100.1.35635 WP_003402100.1.35657 WP_003402100.1.35680 WP_003402100.1.35687 WP_003402100.1.35689 WP_003402100.1.35707 WP_003402100.1.35732 WP_003402100.1.35754 WP_003402100.1.35767 WP_003402100.1.35770 WP_003402100.1.35771 WP_003402100.1.35780 WP_003402100.1.35805 WP_003402100.1.35821 WP_003402100.1.3584 WP_003402100.1.35848 WP_003402100.1.35864 WP_003402100.1.35874 WP_003402100.1.35876 WP_003402100.1.35899 WP_003402100.1.35923 WP_003402100.1.3593 WP_003402100.1.35954 WP_003402100.1.36005 WP_003402100.1.36014 WP_003402100.1.36023 WP_003402100.1.36051 WP_003402100.1.36053 WP_003402100.1.36075 WP_003402100.1.36089 WP_003402100.1.36097 WP_003402100.1.36098 WP_003402100.1.36116 WP_003402100.1.36205 WP_003402100.1.36228 WP_003402100.1.36246 WP_003402100.1.36252 WP_003402100.1.36260 WP_003402100.1.36271 WP_003402100.1.36303 WP_003402100.1.36309 WP_003402100.1.36315 WP_003402100.1.36319 WP_003402100.1.36321 WP_003402100.1.36326 WP_003402100.1.3634 WP_003402100.1.36357 WP_003402100.1.3636 WP_003402100.1.36385 WP_003402100.1.36399 WP_003402100.1.36436 WP_003402100.1.36465 WP_003402100.1.36469 WP_003402100.1.36485 WP_003402100.1.36508 WP_003402100.1.36540 WP_003402100.1.36561 WP_003402100.1.36571 WP_003402100.1.36573 WP_003402100.1.36578 WP_003402100.1.36585 WP_003402100.1.36597 WP_003402100.1.36614 WP_003402100.1.36657 WP_003402100.1.36674 WP_003402100.1.36720 WP_003402100.1.36727 WP_003402100.1.36733 WP_003402100.1.36785 WP_003402100.1.36810 WP_003402100.1.36844 WP_003402100.1.36851 WP_003402100.1.36862 WP_003402100.1.36893 WP_003402100.1.36901 WP_003402100.1.36921 WP_003402100.1.36935 WP_003402100.1.36941 WP_003402100.1.3695 WP_003402100.1.36968 WP_003402100.1.3700 WP_003402100.1.37004 WP_003402100.1.37012 WP_003402100.1.37071 WP_003402100.1.37088 WP_003402100.1.37131 WP_003402100.1.37157 WP_003402100.1.37175 WP_003402100.1.37188 WP_003402100.1.37213 WP_003402100.1.37229 WP_003402100.1.3724 WP_003402100.1.37277 WP_003402100.1.37305 WP_003402100.1.37330 WP_003402100.1.37389 WP_003402100.1.37400 WP_003402100.1.37440 WP_003402100.1.37459 WP_003402100.1.37468 WP_003402100.1.37475 WP_003402100.1.37484 WP_003402100.1.37601 WP_003402100.1.37612 WP_003402100.1.37632 WP_003402100.1.37643 WP_003402100.1.37655 WP_003402100.1.37660 WP_003402100.1.37674 WP_003402100.1.37700 WP_003402100.1.37701 WP_003402100.1.37709 WP_003402100.1.37711 WP_003402100.1.37721 WP_003402100.1.37722 WP_003402100.1.37747 WP_003402100.1.37765 WP_003402100.1.37772 WP_003402100.1.37804 WP_003402100.1.37809 WP_003402100.1.37859 WP_003402100.1.37877 WP_003402100.1.37912 WP_003402100.1.37913 WP_003402100.1.37943 WP_003402100.1.37950 WP_003402100.1.37973 WP_003402100.1.37975 WP_003402100.1.38 WP_003402100.1.38002 WP_003402100.1.3802 WP_003402100.1.38039 WP_003402100.1.38040 WP_003402100.1.38067 WP_003402100.1.38068 WP_003402100.1.38135 WP_003402100.1.38138 WP_003402100.1.38144 WP_003402100.1.38158 WP_003402100.1.38159 WP_003402100.1.38210 WP_003402100.1.38233 WP_003402100.1.38240 WP_003402100.1.38299 WP_003402100.1.38332 WP_003402100.1.38347 WP_003402100.1.38354 WP_003402100.1.38389 WP_003402100.1.38398 WP_003402100.1.38402 WP_003402100.1.38418 WP_003402100.1.38421 WP_003402100.1.38477 WP_003402100.1.38483 WP_003402100.1.3849 WP_003402100.1.385 WP_003402100.1.38530 WP_003402100.1.38539 WP_003402100.1.38594 WP_003402100.1.38611 WP_003402100.1.38638 WP_003402100.1.38639 WP_003402100.1.38646 WP_003402100.1.38648 WP_003402100.1.38654 WP_003402100.1.38660 WP_003402100.1.38666 WP_003402100.1.38671 WP_003402100.1.38672 WP_003402100.1.38677 WP_003402100.1.38750 WP_003402100.1.38772 WP_003402100.1.38812 WP_003402100.1.38821 WP_003402100.1.38844 WP_003402100.1.38863 WP_003402100.1.38865 WP_003402100.1.38873 WP_003402100.1.3889 WP_003402100.1.38894 WP_003402100.1.38909 WP_003402100.1.38939 WP_003402100.1.38974 WP_003402100.1.38975 WP_003402100.1.38991 WP_003402100.1.39025 WP_003402100.1.39070 WP_003402100.1.39072 WP_003402100.1.39095 WP_003402100.1.39106 WP_003402100.1.39165 WP_003402100.1.39174 WP_003402100.1.39176 WP_003402100.1.39178 WP_003402100.1.39190 WP_003402100.1.39201 WP_003402100.1.39207 WP_003402100.1.39236 WP_003402100.1.39239 WP_003402100.1.39252 WP_003402100.1.39288 WP_003402100.1.39295 WP_003402100.1.39306 WP_003402100.1.39359 WP_003402100.1.39364 WP_003402100.1.39400 WP_003402100.1.39447 WP_003402100.1.3945 WP_003402100.1.39450 WP_003402100.1.39455 WP_003402100.1.39521 WP_003402100.1.39560 WP_003402100.1.39592 WP_003402100.1.39593 WP_003402100.1.396 WP_003402100.1.3960 WP_003402100.1.39616 WP_003402100.1.39654 WP_003402100.1.39657 WP_003402100.1.39661 WP_003402100.1.39674 WP_003402100.1.39678 WP_003402100.1.3968 WP_003402100.1.39694 WP_003402100.1.3971 WP_003402100.1.39718 WP_003402100.1.39739 WP_003402100.1.39748 WP_003402100.1.39751 WP_003402100.1.39759 WP_003402100.1.39804 WP_003402100.1.39848 WP_003402100.1.39877 WP_003402100.1.39925 WP_003402100.1.3994 WP_003402100.1.39959 WP_003402100.1.3996 WP_003402100.1.39960 WP_003402100.1.3997 WP_003402100.1.39980 WP_003402100.1.40000 WP_003402100.1.40028 WP_003402100.1.4003 WP_003402100.1.40094 WP_003402100.1.40096 WP_003402100.1.40150 WP_003402100.1.40156 WP_003402100.1.40174 WP_003402100.1.40186 WP_003402100.1.40276 WP_003402100.1.40277 WP_003402100.1.40323 WP_003402100.1.40336 WP_003402100.1.40353 WP_003402100.1.4036 WP_003402100.1.40372 WP_003402100.1.40402 WP_003402100.1.40413 WP_003402100.1.40440 WP_003402100.1.40446 WP_003402100.1.40451 WP_003402100.1.40455 WP_003402100.1.40523 WP_003402100.1.40641 WP_003402100.1.40646 WP_003402100.1.40651 WP_003402100.1.40653 WP_003402100.1.4067 WP_003402100.1.40705 WP_003402100.1.40723 WP_003402100.1.40731 WP_003402100.1.40735 WP_003402100.1.40799 WP_003402100.1.40852 WP_003402100.1.40876 WP_003402100.1.40881 WP_003402100.1.40922 WP_003402100.1.4095 WP_003402100.1.40956 WP_003402100.1.40957 WP_003402100.1.40964 WP_003402100.1.4097 WP_003402100.1.410 WP_003402100.1.41000 WP_003402100.1.41055 WP_003402100.1.41108 WP_003402100.1.41123 WP_003402100.1.41177 WP_003402100.1.41202 WP_003402100.1.41219 WP_003402100.1.41231 WP_003402100.1.41249 WP_003402100.1.4127 WP_003402100.1.41355 WP_003402100.1.41376 WP_003402100.1.41430 WP_003402100.1.41447 WP_003402100.1.41469 WP_003402100.1.41504 WP_003402100.1.41553 WP_003402100.1.41564 WP_003402100.1.41583 WP_003402100.1.41616 WP_003402100.1.41632 WP_003402100.1.41635 WP_003402100.1.41636 WP_003402100.1.41648 WP_003402100.1.41660 WP_003402100.1.41685 WP_003402100.1.41695 WP_003402100.1.41704 WP_003402100.1.4171 WP_003402100.1.41733 WP_003402100.1.41744 WP_003402100.1.41774 WP_003402100.1.41791 WP_003402100.1.41820 WP_003402100.1.41828 WP_003402100.1.41829 WP_003402100.1.41860 WP_003402100.1.41912 WP_003402100.1.41921 WP_003402100.1.41933 WP_003402100.1.41944 WP_003402100.1.42078 WP_003402100.1.42094 WP_003402100.1.42112 WP_003402100.1.4212 WP_003402100.1.42122 WP_003402100.1.42134 WP_003402100.1.42183 WP_003402100.1.42188 WP_003402100.1.42201 WP_003402100.1.42202 WP_003402100.1.42208 WP_003402100.1.42247 WP_003402100.1.42255 WP_003402100.1.42273 WP_003402100.1.42278 WP_003402100.1.42304 WP_003402100.1.42309 WP_003402100.1.42370 WP_003402100.1.42385 WP_003402100.1.42400 WP_003402100.1.42409 WP_003402100.1.42414 WP_003402100.1.42417 WP_003402100.1.42430 WP_003402100.1.42461 WP_003402100.1.42465 WP_003402100.1.42467 WP_003402100.1.42473 WP_003402100.1.42474 WP_003402100.1.4248 WP_003402100.1.42494 WP_003402100.1.42519 WP_003402100.1.42524 WP_003402100.1.42534 WP_003402100.1.4255 WP_003402100.1.42562 WP_003402100.1.42568 WP_003402100.1.42570 WP_003402100.1.42618 WP_003402100.1.42660 WP_003402100.1.42695 WP_003402100.1.42704 WP_003402100.1.42705 WP_003402100.1.42722 WP_003402100.1.42777 WP_003402100.1.42782 WP_003402100.1.42835 WP_003402100.1.42839 WP_003402100.1.42842 WP_003402100.1.42905 WP_003402100.1.42916 WP_003402100.1.42930 WP_003402100.1.42971 WP_003402100.1.43005 WP_003402100.1.43009 WP_003402100.1.43053 WP_003402100.1.43082 WP_003402100.1.43087 WP_003402100.1.43098 WP_003402100.1.43208 WP_003402100.1.43236 WP_003402100.1.43246 WP_003402100.1.43255 WP_003402100.1.43266 WP_003402100.1.43269 WP_003402100.1.43273 WP_003402100.1.43296 WP_003402100.1.43306 WP_003402100.1.4335 WP_003402100.1.43368 WP_003402100.1.43395 WP_003402100.1.43457 WP_003402100.1.43462 WP_003402100.1.43475 WP_003402100.1.43478 WP_003402100.1.43484 WP_003402100.1.43557 WP_003402100.1.43578 WP_003402100.1.43588 WP_003402100.1.43664 WP_003402100.1.43684 WP_003402100.1.43686 WP_003402100.1.43706 WP_003402100.1.43716 WP_003402100.1.4377 WP_003402100.1.43781 WP_003402100.1.43794 WP_003402100.1.43815 WP_003402100.1.43846 WP_003402100.1.43861 WP_003402100.1.43863 WP_003402100.1.43866 WP_003402100.1.43872 WP_003402100.1.43885 WP_003402100.1.43897 WP_003402100.1.4390 WP_003402100.1.43902 WP_003402100.1.43921 WP_003402100.1.43936 WP_003402100.1.43937 WP_003402100.1.43960 WP_003402100.1.43965 WP_003402100.1.4399 WP_003402100.1.43993 WP_003402100.1.43996 WP_003402100.1.44 WP_003402100.1.44001 WP_003402100.1.44008 WP_003402100.1.44033 WP_003402100.1.44037 WP_003402100.1.44070 WP_003402100.1.44071 WP_003402100.1.44076 WP_003402100.1.44104 WP_003402100.1.44111 WP_003402100.1.44124 WP_003402100.1.44169 WP_003402100.1.44219 WP_003402100.1.44237 WP_003402100.1.44277 WP_003402100.1.44279 WP_003402100.1.44336 WP_003402100.1.44355 WP_003402100.1.44358 WP_003402100.1.4438 WP_003402100.1.44390 WP_003402100.1.44392 WP_003402100.1.4441 WP_003402100.1.44415 WP_003402100.1.44464 WP_003402100.1.44466 WP_003402100.1.44489 WP_003402100.1.44492 WP_003402100.1.44494 WP_003402100.1.44500 WP_003402100.1.44532 WP_003402100.1.44534 WP_003402100.1.44562 WP_003402100.1.44597 WP_003402100.1.44600 WP_003402100.1.44602 WP_003402100.1.44615 WP_003402100.1.4464 WP_003402100.1.44651 WP_003402100.1.44659 WP_003402100.1.44665 WP_003402100.1.44694 WP_003402100.1.44700 WP_003402100.1.44713 WP_003402100.1.44735 WP_003402100.1.44740 WP_003402100.1.44757 WP_003402100.1.4476 WP_003402100.1.44761 WP_003402100.1.44776 WP_003402100.1.44786 WP_003402100.1.44808 WP_003402100.1.44864 WP_003402100.1.44901 WP_003402100.1.44908 WP_003402100.1.44913 WP_003402100.1.4492 WP_003402100.1.44939 WP_003402100.1.44979 WP_003402100.1.44981 WP_003402100.1.45002 WP_003402100.1.45011 WP_003402100.1.4504 WP_003402100.1.45081 WP_003402100.1.45113 WP_003402100.1.45129 WP_003402100.1.45135 WP_003402100.1.45147 WP_003402100.1.45168 WP_003402100.1.4517 WP_003402100.1.45181 WP_003402100.1.45185 WP_003402100.1.45192 WP_003402100.1.45200 WP_003402100.1.45205 WP_003402100.1.45211 WP_003402100.1.45249 WP_003402100.1.4526 WP_003402100.1.45286 WP_003402100.1.45326 WP_003402100.1.45347 WP_003402100.1.45374 WP_003402100.1.45390 WP_003402100.1.45407 WP_003402100.1.45451 WP_003402100.1.45453 WP_003402100.1.45460 WP_003402100.1.45463 WP_003402100.1.45470 WP_003402100.1.45474 WP_003402100.1.45491 WP_003402100.1.45510 WP_003402100.1.45563 WP_003402100.1.45584 WP_003402100.1.45590 WP_003402100.1.45619 WP_003402100.1.45626 WP_003402100.1.45631 WP_003402100.1.45666 WP_003402100.1.45697 WP_003402100.1.4571 WP_003402100.1.45731 WP_003402100.1.45743 WP_003402100.1.45776 WP_003402100.1.45805 WP_003402100.1.45815 WP_003402100.1.45849 WP_003402100.1.4590 WP_003402100.1.45923 WP_003402100.1.45926 WP_003402100.1.45963 WP_003402100.1.45992 WP_003402100.1.46025 WP_003402100.1.46083 WP_003402100.1.46090 WP_003402100.1.46092 WP_003402100.1.46100 WP_003402100.1.46101 WP_003402100.1.46103 WP_003402100.1.46107 WP_003402100.1.46127 WP_003402100.1.46129 WP_003402100.1.46141 WP_003402100.1.46150 WP_003402100.1.46201 WP_003402100.1.46226 WP_003402100.1.4624 WP_003402100.1.46253 WP_003402100.1.46268 WP_003402100.1.46285 WP_003402100.1.46300 WP_003402100.1.46313 WP_003402100.1.46336 WP_003402100.1.46365 WP_003402100.1.46370 WP_003402100.1.46381 WP_003402100.1.46411 WP_003402100.1.4644 WP_003402100.1.46442 WP_003402100.1.46453 WP_003402100.1.46463 WP_003402100.1.46478 WP_003402100.1.46492 WP_003402100.1.46521 WP_003402100.1.4653 WP_003402100.1.46532 WP_003402100.1.46539 WP_003402100.1.46568 WP_003402100.1.46585 WP_003402100.1.46609 WP_003402100.1.46613 WP_003402100.1.46625 WP_003402100.1.46642 WP_003402100.1.46647 WP_003402100.1.46674 WP_003402100.1.46724 WP_003402100.1.46758 WP_003402100.1.46773 WP_003402100.1.46777 WP_003402100.1.46792 WP_003402100.1.46847 WP_003402100.1.46851 WP_003402100.1.4687 WP_003402100.1.46936 WP_003402100.1.46980 WP_003402100.1.47011 WP_003402100.1.47066 WP_003402100.1.47083 WP_003402100.1.47106 WP_003402100.1.47142 WP_003402100.1.47147 WP_003402100.1.47166 WP_003402100.1.47178 WP_003402100.1.47179 WP_003402100.1.47194 WP_003402100.1.47207 WP_003402100.1.47210 WP_003402100.1.47261 WP_003402100.1.47262 WP_003402100.1.47423 WP_003402100.1.47467 WP_003402100.1.47502 WP_003402100.1.4751 WP_003402100.1.47511 WP_003402100.1.47537 WP_003402100.1.47540 WP_003402100.1.47568 WP_003402100.1.47572 WP_003402100.1.47588 WP_003402100.1.47636 WP_003402100.1.47653 WP_003402100.1.47679 WP_003402100.1.47681 WP_003402100.1.47690 WP_003402100.1.4771 WP_003402100.1.47717 WP_003402100.1.47743 WP_003402100.1.47754 WP_003402100.1.47773 WP_003402100.1.47776 WP_003402100.1.47780 WP_003402100.1.47805 WP_003402100.1.47832 WP_003402100.1.47847 WP_003402100.1.47858 WP_003402100.1.47861 WP_003402100.1.47868 WP_003402100.1.47893 WP_003402100.1.47899 WP_003402100.1.479 WP_003402100.1.47912 WP_003402100.1.47913 WP_003402100.1.47926 WP_003402100.1.4794 WP_003402100.1.47943 WP_003402100.1.47944 WP_003402100.1.47959 WP_003402100.1.47974 WP_003402100.1.47993 WP_003402100.1.48004 WP_003402100.1.48039 WP_003402100.1.48050 WP_003402100.1.48084 WP_003402100.1.48097 WP_003402100.1.48101 WP_003402100.1.48109 WP_003402100.1.4813 WP_003402100.1.48130 WP_003402100.1.48135 WP_003402100.1.48143 WP_003402100.1.48155 WP_003402100.1.48170 WP_003402100.1.48173 WP_003402100.1.48177 WP_003402100.1.48185 WP_003402100.1.48219 WP_003402100.1.4823 WP_003402100.1.48240 WP_003402100.1.48256 WP_003402100.1.48264 WP_003402100.1.48287 WP_003402100.1.48330 WP_003402100.1.48333 WP_003402100.1.48348 WP_003402100.1.48354 WP_003402100.1.48372 WP_003402100.1.48383 WP_003402100.1.48388 WP_003402100.1.48419 WP_003402100.1.48423 WP_003402100.1.48443 WP_003402100.1.48462 WP_003402100.1.48543 WP_003402100.1.48550 WP_003402100.1.48605 WP_003402100.1.48618 WP_003402100.1.4863 WP_003402100.1.48648 WP_003402100.1.48658 WP_003402100.1.48666 WP_003402100.1.48687 WP_003402100.1.48779 WP_003402100.1.4878 WP_003402100.1.48798 WP_003402100.1.48802 WP_003402100.1.48826 WP_003402100.1.48843 WP_003402100.1.48857 WP_003402100.1.4890 WP_003402100.1.48946 WP_003402100.1.48979 WP_003402100.1.49017 WP_003402100.1.49048 WP_003402100.1.49059 WP_003402100.1.4906 WP_003402100.1.4907 WP_003402100.1.49103 WP_003402100.1.49110 WP_003402100.1.4919 WP_003402100.1.49251 WP_003402100.1.49254 WP_003402100.1.49263 WP_003402100.1.49291 WP_003402100.1.49337 WP_003402100.1.49419 WP_003402100.1.49426 WP_003402100.1.49437 WP_003402100.1.49439 WP_003402100.1.49474 WP_003402100.1.49506 WP_003402100.1.49516 WP_003402100.1.49523 WP_003402100.1.49526 WP_003402100.1.49532 WP_003402100.1.4959 WP_003402100.1.49678 WP_003402100.1.49687 WP_003402100.1.49699 WP_003402100.1.49709 WP_003402100.1.4971 WP_003402100.1.4972 WP_003402100.1.49736 WP_003402100.1.49746 WP_003402100.1.49764 WP_003402100.1.49796 WP_003402100.1.49814 WP_003402100.1.49815 WP_003402100.1.49816 WP_003402100.1.49839 WP_003402100.1.49857 WP_003402100.1.49878 WP_003402100.1.49880 WP_003402100.1.49944 WP_003402100.1.4999 WP_003402100.1.49990 WP_003402100.1.50068 WP_003402100.1.5008 WP_003402100.1.50081 WP_003402100.1.50122 WP_003402100.1.50126 WP_003402100.1.50149 WP_003402100.1.50162 WP_003402100.1.5018 WP_003402100.1.50194 WP_003402100.1.50218 WP_003402100.1.50235 WP_003402100.1.50249 WP_003402100.1.50265 WP_003402100.1.50271 WP_003402100.1.50324 WP_003402100.1.50347 WP_003402100.1.50372 WP_003402100.1.50398 WP_003402100.1.50407 WP_003402100.1.50444 WP_003402100.1.50466 WP_003402100.1.50472 WP_003402100.1.5048 WP_003402100.1.50498 WP_003402100.1.5050 WP_003402100.1.50540 WP_003402100.1.50554 WP_003402100.1.50557 WP_003402100.1.50601 WP_003402100.1.50610 WP_003402100.1.50632 WP_003402100.1.50633 WP_003402100.1.50642 WP_003402100.1.50655 WP_003402100.1.50659 WP_003402100.1.50683 WP_003402100.1.50689 WP_003402100.1.50692 WP_003402100.1.50714 WP_003402100.1.50729 WP_003402100.1.50756 WP_003402100.1.50784 WP_003402100.1.50794 WP_003402100.1.50841 WP_003402100.1.50860 WP_003402100.1.50868 WP_003402100.1.50877 WP_003402100.1.5096 WP_003402100.1.50981 WP_003402100.1.50987 WP_003402100.1.51003 WP_003402100.1.51009 WP_003402100.1.51037 WP_003402100.1.51074 WP_003402100.1.51082 WP_003402100.1.51101 WP_003402100.1.51116 WP_003402100.1.51149 WP_003402100.1.51157 WP_003402100.1.51213 WP_003402100.1.51232 WP_003402100.1.51239 WP_003402100.1.51247 WP_003402100.1.51266 WP_003402100.1.51279 WP_003402100.1.51291 WP_003402100.1.51294 WP_003402100.1.51301 WP_003402100.1.51329 WP_003402100.1.51391 WP_003402100.1.51422 WP_003402100.1.51445 WP_003402100.1.51455 WP_003402100.1.51466 WP_003402100.1.51468 WP_003402100.1.51478 WP_003402100.1.51497 WP_003402100.1.51520 WP_003402100.1.51593 WP_003402100.1.51628 WP_003402100.1.5164 WP_003402100.1.51647 WP_003402100.1.51660 WP_003402100.1.51696 WP_003402100.1.51721 WP_003402100.1.51788 WP_003402100.1.51795 WP_003402100.1.51801 WP_003402100.1.51817 WP_003402100.1.51819 WP_003402100.1.51854 WP_003402100.1.51923 WP_003402100.1.51942 WP_003402100.1.51948 WP_003402100.1.51963 WP_003402100.1.51969 WP_003402100.1.52000 WP_003402100.1.52001 WP_003402100.1.52003 WP_003402100.1.52006 WP_003402100.1.52036 WP_003402100.1.52046 WP_003402100.1.52059 WP_003402100.1.52069 WP_003402100.1.52082 WP_003402100.1.52102 WP_003402100.1.52166 WP_003402100.1.52168 WP_003402100.1.52173 WP_003402100.1.52178 WP_003402100.1.52206 WP_003402100.1.52216 WP_003402100.1.52238 WP_003402100.1.52241 WP_003402100.1.52280 WP_003402100.1.52314 WP_003402100.1.52385 WP_003402100.1.52390 WP_003402100.1.524 WP_003402100.1.52460 WP_003402100.1.52485 WP_003402100.1.52486 WP_003402100.1.52504 WP_003402100.1.52522 WP_003402100.1.52531 WP_003402100.1.52533 WP_003402100.1.52545 WP_003402100.1.52553 WP_003402100.1.52563 WP_003402100.1.52564 WP_003402100.1.52574 WP_003402100.1.52641 WP_003402100.1.52673 WP_003402100.1.52674 WP_003402100.1.52708 WP_003402100.1.52713 WP_003402100.1.52761 WP_003402100.1.52778 WP_003402100.1.52797 WP_003402100.1.52818 WP_003402100.1.52872 WP_003402100.1.52873 WP_003402100.1.52891 WP_003402100.1.52892 WP_003402100.1.52909 WP_003402100.1.52970 WP_003402100.1.52998 WP_003402100.1.53053 WP_003402100.1.53056 WP_003402100.1.5306 WP_003402100.1.53088 WP_003402100.1.5309 WP_003402100.1.531 WP_003402100.1.53117 WP_003402100.1.53118 WP_003402100.1.53142 WP_003402100.1.53143 WP_003402100.1.53157 WP_003402100.1.53167 WP_003402100.1.53200 WP_003402100.1.53204 WP_003402100.1.53213 WP_003402100.1.53217 WP_003402100.1.53226 WP_003402100.1.53229 WP_003402100.1.53230 WP_003402100.1.53237 WP_003402100.1.53254 WP_003402100.1.53257 WP_003402100.1.5327 WP_003402100.1.53276 WP_003402100.1.53278 WP_003402100.1.533 WP_003402100.1.53306 WP_003402100.1.5334 WP_003402100.1.5335 WP_003402100.1.53353 WP_003402100.1.53381 WP_003402100.1.53413 WP_003402100.1.53458 WP_003402100.1.53460 WP_003402100.1.53480 WP_003402100.1.53517 WP_003402100.1.53522 WP_003402100.1.53525 WP_003402100.1.53526 WP_003402100.1.53553 WP_003402100.1.53606 WP_003402100.1.53628 WP_003402100.1.53643 WP_003402100.1.53667 WP_003402100.1.53679 WP_003402100.1.53715 WP_003402100.1.53730 WP_003402100.1.53742 WP_003402100.1.53743 WP_003402100.1.53754 WP_003402100.1.53775 WP_003402100.1.53787 WP_003402100.1.53803 WP_003402100.1.53818 WP_003402100.1.53822 WP_003402100.1.53853 WP_003402100.1.53865 WP_003402100.1.53888 WP_003402100.1.53900 WP_003402100.1.53912 WP_003402100.1.53914 WP_003402100.1.53952 WP_003402100.1.5398 WP_003402100.1.5408 WP_003402100.1.54089 WP_003402100.1.54093 WP_003402100.1.54099 WP_003402100.1.54112 WP_003402100.1.54125 WP_003402100.1.54141 WP_003402100.1.54162 WP_003402100.1.54179 WP_003402100.1.54206 WP_003402100.1.54218 WP_003402100.1.54225 WP_003402100.1.54227 WP_003402100.1.54232 WP_003402100.1.54241 WP_003402100.1.54245 WP_003402100.1.54247 WP_003402100.1.54260 WP_003402100.1.54275 WP_003402100.1.54280 WP_003402100.1.5429 WP_003402100.1.54294 WP_003402100.1.54314 WP_003402100.1.54347 WP_003402100.1.54351 WP_003402100.1.54370 WP_003402100.1.54428 WP_003402100.1.54449 WP_003402100.1.54494 WP_003402100.1.54502 WP_003402100.1.54514 WP_003402100.1.54519 WP_003402100.1.5452 WP_003402100.1.54531 WP_003402100.1.54537 WP_003402100.1.54553 WP_003402100.1.54555 WP_003402100.1.54575 WP_003402100.1.54633 WP_003402100.1.54686 WP_003402100.1.54687 WP_003402100.1.54705 WP_003402100.1.54730 WP_003402100.1.54732 WP_003402100.1.5475 WP_003402100.1.54807 WP_003402100.1.54836 WP_003402100.1.54838 WP_003402100.1.54860 WP_003402100.1.54888 WP_003402100.1.54897 WP_003402100.1.54905 WP_003402100.1.54909 WP_003402100.1.54937 WP_003402100.1.54939 WP_003402100.1.54944 WP_003402100.1.54945 WP_003402100.1.54953 WP_003402100.1.54964 WP_003402100.1.55015 WP_003402100.1.55022 WP_003402100.1.55023 WP_003402100.1.55051 WP_003402100.1.55072 WP_003402100.1.55088 WP_003402100.1.55106 WP_003402100.1.55126 WP_003402100.1.55210 WP_003402100.1.55227 WP_003402100.1.55248 WP_003402100.1.55257 WP_003402100.1.55258 WP_003402100.1.55267 WP_003402100.1.55279 WP_003402100.1.55307 WP_003402100.1.55328 WP_003402100.1.5533 WP_003402100.1.55345 WP_003402100.1.55396 WP_003402100.1.55398 WP_003402100.1.55441 WP_003402100.1.55459 WP_003402100.1.55501 WP_003402100.1.55578 WP_003402100.1.55626 WP_003402100.1.55641 WP_003402100.1.5569 WP_003402100.1.55723 WP_003402100.1.55735 WP_003402100.1.5574 WP_003402100.1.55772 WP_003402100.1.55802 WP_003402100.1.55807 WP_003402100.1.55819 WP_003402100.1.55821 WP_003402100.1.5583 WP_003402100.1.55849 WP_003402100.1.55856 WP_003402100.1.55860 WP_003402100.1.55882 WP_003402100.1.55883 WP_003402100.1.55894 WP_003402100.1.55902 WP_003402100.1.55908 WP_003402100.1.55909 WP_003402100.1.5591 WP_003402100.1.55961 WP_003402100.1.55977 WP_003402100.1.55983 WP_003402100.1.56028 WP_003402100.1.56057 WP_003402100.1.56060 WP_003402100.1.56107 WP_003402100.1.56132 WP_003402100.1.56163 WP_003402100.1.56167 WP_003402100.1.56178 WP_003402100.1.56287 WP_003402100.1.56292 WP_003402100.1.56327 WP_003402100.1.56341 WP_003402100.1.56359 WP_003402100.1.56365 WP_003402100.1.56394 WP_003402100.1.56443 WP_003402100.1.56478 WP_003402100.1.56500 WP_003402100.1.56517 WP_003402100.1.5656 WP_003402100.1.56577 WP_003402100.1.56593 WP_003402100.1.56625 WP_003402100.1.56637 WP_003402100.1.56670 WP_003402100.1.56697 WP_003402100.1.56701 WP_003402100.1.56729 WP_003402100.1.56743 WP_003402100.1.56755 WP_003402100.1.56764 WP_003402100.1.56769 WP_003402100.1.56770 WP_003402100.1.56795 WP_003402100.1.5681 WP_003402100.1.56827 WP_003402100.1.56839 WP_003402100.1.56863 WP_003402100.1.56868 WP_003402100.1.56869 WP_003402100.1.56915 WP_003402100.1.56926 WP_003402100.1.56961 WP_003402100.1.56971 WP_003402100.1.56972 WP_003402100.1.57023 WP_003402100.1.57035 WP_003402100.1.57077 WP_003402100.1.57087 WP_003402100.1.57094 WP_003402100.1.57134 WP_003402100.1.57169 WP_003402100.1.57208 WP_003402100.1.57212 WP_003402100.1.57230 WP_003402100.1.5724 WP_003402100.1.5725 WP_003402100.1.5727 WP_003402100.1.57273 WP_003402100.1.573 WP_003402100.1.57326 WP_003402100.1.57328 WP_003402100.1.57340 WP_003402100.1.57351 WP_003402100.1.57380 WP_003402100.1.57430 WP_003402100.1.5744 WP_003402100.1.57440 WP_003402100.1.5745 WP_003402100.1.57461 WP_003402100.1.57469 WP_003402100.1.57489 WP_003402100.1.575 WP_003402100.1.57509 WP_003402100.1.57519 WP_003402100.1.57525 WP_003402100.1.57551 WP_003402100.1.5758 WP_003402100.1.57596 WP_003402100.1.57604 WP_003402100.1.57616 WP_003402100.1.57619 WP_003402100.1.57627 WP_003402100.1.57642 WP_003402100.1.57658 WP_003402100.1.57667 WP_003402100.1.57675 WP_003402100.1.57689 WP_003402100.1.57708 WP_003402100.1.57821 WP_003402100.1.57825 WP_003402100.1.57843 WP_003402100.1.57906 WP_003402100.1.57924 WP_003402100.1.57926 WP_003402100.1.57957 WP_003402100.1.57960 WP_003402100.1.57964 WP_003402100.1.57991 WP_003402100.1.58000 WP_003402100.1.58086 WP_003402100.1.58101 WP_003402100.1.58103 WP_003402100.1.58108 WP_003402100.1.58121 WP_003402100.1.58145 WP_003402100.1.58164 WP_003402100.1.58174 WP_003402100.1.582 WP_003402100.1.58209 WP_003402100.1.5824 WP_003402100.1.58250 WP_003402100.1.58259 WP_003402100.1.58288 WP_003402100.1.5830 WP_003402100.1.58303 WP_003402100.1.58311 WP_003402100.1.58386 WP_003402100.1.58393 WP_003402100.1.58431 WP_003402100.1.5844 WP_003402100.1.58457 WP_003402100.1.58488 WP_003402100.1.58518 WP_003402100.1.58534 WP_003402100.1.58559 WP_003402100.1.58567 WP_003402100.1.58573 WP_003402100.1.58602 WP_003402100.1.58612 WP_003402100.1.58619 WP_003402100.1.58630 WP_003402100.1.5865 WP_003402100.1.58671 WP_003402100.1.58690 WP_003402100.1.58702 WP_003402100.1.58743 WP_003402100.1.58754 WP_003402100.1.5879 WP_003402100.1.5881 WP_003402100.1.58824 WP_003402100.1.58848 WP_003402100.1.58857 WP_003402100.1.58891 WP_003402100.1.58892 WP_003402100.1.5890 WP_003402100.1.58904 WP_003402100.1.58921 WP_003402100.1.58930 WP_003402100.1.58953 WP_003402100.1.58961 WP_003402100.1.5898 WP_003402100.1.59025 WP_003402100.1.59029 WP_003402100.1.59037 WP_003402100.1.59044 WP_003402100.1.59088 WP_003402100.1.59112 WP_003402100.1.59130 WP_003402100.1.5914 WP_003402100.1.59147 WP_003402100.1.59166 WP_003402100.1.59205 WP_003402100.1.59209 WP_003402100.1.59237 WP_003402100.1.59240 WP_003402100.1.59253 WP_003402100.1.59254 WP_003402100.1.59262 WP_003402100.1.59270 WP_003402100.1.5928 WP_003402100.1.59304 WP_003402100.1.59305 WP_003402100.1.59309 WP_003402100.1.59316 WP_003402100.1.59326 WP_003402100.1.59328 WP_003402100.1.59333 WP_003402100.1.59338 WP_003402100.1.59428 WP_003402100.1.59487 WP_003402100.1.59537 WP_003402100.1.59561 WP_003402100.1.59677 WP_003402100.1.59722 WP_003402100.1.59732 WP_003402100.1.59738 WP_003402100.1.59750 WP_003402100.1.59757 WP_003402100.1.59761 WP_003402100.1.59808 WP_003402100.1.59850 WP_003402100.1.59860 WP_003402100.1.59861 WP_003402100.1.5987 WP_003402100.1.59878 WP_003402100.1.59888 WP_003402100.1.59952 WP_003402100.1.5996 WP_003402100.1.59961 WP_003402100.1.59974 WP_003402100.1.6000 WP_003402100.1.6003 WP_003402100.1.60047 WP_003402100.1.6007 WP_003402100.1.60121 WP_003402100.1.60135 WP_003402100.1.60139 WP_003402100.1.60152 WP_003402100.1.60171 WP_003402100.1.60197 WP_003402100.1.6020 WP_003402100.1.60205 WP_003402100.1.60207 WP_003402100.1.60215 WP_003402100.1.60217 WP_003402100.1.60267 WP_003402100.1.60288 WP_003402100.1.60291 WP_003402100.1.60301 WP_003402100.1.60305 WP_003402100.1.60312 WP_003402100.1.60313 WP_003402100.1.60314 WP_003402100.1.60367 WP_003402100.1.60403 WP_003402100.1.60413 WP_003402100.1.60421 WP_003402100.1.60451 WP_003402100.1.60460 WP_003402100.1.60487 WP_003402100.1.60512 WP_003402100.1.60573 WP_003402100.1.60583 WP_003402100.1.60632 WP_003402100.1.60657 WP_003402100.1.60687 WP_003402100.1.60689 WP_003402100.1.60727 WP_003402100.1.60738 WP_003402100.1.60763 WP_003402100.1.6077 WP_003402100.1.60791 WP_003402100.1.60834 WP_003402100.1.60878 WP_003402100.1.60879 WP_003402100.1.60913 WP_003402100.1.60978 WP_003402100.1.61000 WP_003402100.1.61001 WP_003402100.1.61012 WP_003402100.1.61014 WP_003402100.1.61015 WP_003402100.1.61037 WP_003402100.1.61052 WP_003402100.1.61065 WP_003402100.1.61100 WP_003402100.1.61101 WP_003402100.1.61138 WP_003402100.1.61142 WP_003402100.1.61198 WP_003402100.1.61234 WP_003402100.1.61256 WP_003402100.1.61281 WP_003402100.1.61314 WP_003402100.1.61321 WP_003402100.1.61326 WP_003402100.1.61328 WP_003402100.1.61368 WP_003402100.1.61391 WP_003402100.1.61406 WP_003402100.1.61409 WP_003402100.1.61420 WP_003402100.1.61422 WP_003402100.1.61425 WP_003402100.1.61428 WP_003402100.1.61469 WP_003402100.1.61522 WP_003402100.1.61552 WP_003402100.1.61557 WP_003402100.1.61567 WP_003402100.1.61571 WP_003402100.1.61573 WP_003402100.1.61586 WP_003402100.1.6159 WP_003402100.1.61592 WP_003402100.1.6160 WP_003402100.1.61614 WP_003402100.1.6163 WP_003402100.1.61655 WP_003402100.1.61665 WP_003402100.1.61669 WP_003402100.1.61682 WP_003402100.1.61692 WP_003402100.1.61719 WP_003402100.1.61728 WP_003402100.1.61750 WP_003402100.1.61754 WP_003402100.1.61755 WP_003402100.1.61757 WP_003402100.1.61778 WP_003402100.1.6179 WP_003402100.1.61816 WP_003402100.1.61842 WP_003402100.1.61850 WP_003402100.1.61862 WP_003402100.1.61865 WP_003402100.1.61868 WP_003402100.1.61911 WP_003402100.1.61941 WP_003402100.1.61953 WP_003402100.1.61979 WP_003402100.1.61986 WP_003402100.1.61987 WP_003402100.1.61998 WP_003402100.1.62021 WP_003402100.1.62087 WP_003402100.1.62089 WP_003402100.1.62101 WP_003402100.1.62104 WP_003402100.1.6211 WP_003402100.1.62132 WP_003402100.1.62162 WP_003402100.1.62225 WP_003402100.1.62230 WP_003402100.1.62238 WP_003402100.1.62249 WP_003402100.1.62270 WP_003402100.1.62281 WP_003402100.1.62307 WP_003402100.1.6231 WP_003402100.1.62359 WP_003402100.1.62360 WP_003402100.1.62371 WP_003402100.1.62379 WP_003402100.1.62395 WP_003402100.1.62449 WP_003402100.1.62468 WP_003402100.1.6248 WP_003402100.1.62508 WP_003402100.1.62565 WP_003402100.1.62606 WP_003402100.1.62616 WP_003402100.1.62666 WP_003402100.1.62687 WP_003402100.1.62715 WP_003402100.1.62730 WP_003402100.1.62738 WP_003402100.1.62761 WP_003402100.1.62766 WP_003402100.1.62813 WP_003402100.1.62839 WP_003402100.1.62841 WP_003402100.1.62909 WP_003402100.1.62936 WP_003402100.1.6294 WP_003402100.1.6295 WP_003402100.1.62962 WP_003402100.1.63007 WP_003402100.1.63019 WP_003402100.1.63032 WP_003402100.1.63037 WP_003402100.1.63064 WP_003402100.1.63066 WP_003402100.1.63072 WP_003402100.1.6308 WP_003402100.1.63096 WP_003402100.1.63106 WP_003402100.1.63144 WP_003402100.1.63160 WP_003402100.1.63161 WP_003402100.1.63166 WP_003402100.1.63175 WP_003402100.1.63194 WP_003402100.1.63222 WP_003402100.1.63247 WP_003402100.1.6328 WP_003402100.1.63291 WP_003402100.1.63312 WP_003402100.1.63317 WP_003402100.1.63331 WP_003402100.1.63373 WP_003402100.1.63384 WP_003402100.1.63403 WP_003402100.1.63424 WP_003402100.1.63428 WP_003402100.1.6345 WP_003402100.1.63464 WP_003402100.1.63483 WP_003402100.1.63502 WP_003402100.1.63504 WP_003402100.1.63522 WP_003402100.1.63530 WP_003402100.1.63564 WP_003402100.1.63567 WP_003402100.1.63596 WP_003402100.1.63600 WP_003402100.1.63623 WP_003402100.1.63624 WP_003402100.1.63625 WP_003402100.1.63627 WP_003402100.1.63654 WP_003402100.1.63662 WP_003402100.1.63711 WP_003402100.1.63734 WP_003402100.1.63807 WP_003402100.1.63819 WP_003402100.1.63844 WP_003402100.1.63888 WP_003402100.1.63913 WP_003402100.1.63915 WP_003402100.1.63918 WP_003402100.1.63970 WP_003402100.1.64000 WP_003402100.1.64027 WP_003402100.1.64058 WP_003402100.1.64065 WP_003402100.1.6407 WP_003402100.1.64082 WP_003402100.1.64091 WP_003402100.1.64102 WP_003402100.1.64104 WP_003402100.1.64169 WP_003402100.1.64219 WP_003402100.1.6422 WP_003402100.1.64222 WP_003402100.1.64223 WP_003402100.1.64228 WP_003402100.1.64235 WP_003402100.1.64249 WP_003402100.1.6427 WP_003402100.1.64278 WP_003402100.1.64287 WP_003402100.1.64414 WP_003402100.1.64419 WP_003402100.1.6443 WP_003402100.1.64463 WP_003402100.1.64480 WP_003402100.1.64497 WP_003402100.1.64506 WP_003402100.1.64513 WP_003402100.1.64515 WP_003402100.1.64522 WP_003402100.1.64526 WP_003402100.1.64543 WP_003402100.1.6456 WP_003402100.1.64567 WP_003402100.1.64588 WP_003402100.1.64589 WP_003402100.1.64594 WP_003402100.1.64608 WP_003402100.1.64619 WP_003402100.1.64629 WP_003402100.1.6464 WP_003402100.1.64664 WP_003402100.1.64669 WP_003402100.1.64680 WP_003402100.1.64682 WP_003402100.1.64727 WP_003402100.1.64729 WP_003402100.1.64774 WP_003402100.1.64776 WP_003402100.1.64832 WP_003402100.1.6486 WP_003402100.1.64870 WP_003402100.1.64898 WP_003402100.1.64922 WP_003402100.1.64924 WP_003402100.1.6493 WP_003402100.1.64941 WP_003402100.1.64966 WP_003402100.1.64973 WP_003402100.1.65001 WP_003402100.1.65026 WP_003402100.1.65053 WP_003402100.1.65070 WP_003402100.1.65079 WP_003402100.1.65102 WP_003402100.1.65157 WP_003402100.1.65181 WP_003402100.1.65212 WP_003402100.1.65229 WP_003402100.1.6523 WP_003402100.1.65253 WP_003402100.1.65289 WP_003402100.1.65291 WP_003402100.1.65315 WP_003402100.1.65329 WP_003402100.1.6536 WP_003402100.1.65374 WP_003402100.1.65414 WP_003402100.1.65416 WP_003402100.1.65433 WP_003402100.1.65455 WP_003402100.1.65467 WP_003402100.1.65488 WP_003402100.1.65529 WP_003402100.1.65539 WP_003402100.1.65583 WP_003402100.1.65612 WP_003402100.1.65623 WP_003402100.1.65635 WP_003402100.1.65637 WP_003402100.1.65683 WP_003402100.1.65686 WP_003402100.1.65688 WP_003402100.1.65707 WP_003402100.1.65733 WP_003402100.1.65746 WP_003402100.1.65747 WP_003402100.1.65759 WP_003402100.1.65816 WP_003402100.1.65830 WP_003402100.1.65858 WP_003402100.1.65862 WP_003402100.1.65869 WP_003402100.1.65893 WP_003402100.1.65929 WP_003402100.1.65932 WP_003402100.1.65958 WP_003402100.1.65974 WP_003402100.1.66004 WP_003402100.1.66013 WP_003402100.1.6606 WP_003402100.1.66089 WP_003402100.1.66149 WP_003402100.1.66151 WP_003402100.1.66276 WP_003402100.1.66293 WP_003402100.1.66297 WP_003402100.1.66323 WP_003402100.1.66325 WP_003402100.1.6633 WP_003402100.1.66334 WP_003402100.1.66355 WP_003402100.1.66367 WP_003402100.1.66394 WP_003402100.1.66396 WP_003402100.1.66451 WP_003402100.1.66455 WP_003402100.1.66457 WP_003402100.1.66460 WP_003402100.1.66464 WP_003402100.1.66466 WP_003402100.1.66487 WP_003402100.1.66504 WP_003402100.1.66544 WP_003402100.1.66558 WP_003402100.1.66580 WP_003402100.1.66582 WP_003402100.1.66612 WP_003402100.1.66615 WP_003402100.1.66617 WP_003402100.1.66635 WP_003402100.1.66656 WP_003402100.1.66663 WP_003402100.1.66675 WP_003402100.1.66715 WP_003402100.1.66718 WP_003402100.1.66762 WP_003402100.1.66776 WP_003402100.1.66808 WP_003402100.1.66817 WP_003402100.1.66819 WP_003402100.1.66826 WP_003402100.1.66842 WP_003402100.1.66868 WP_003402100.1.66878 WP_003402100.1.66880 WP_003402100.1.66893 WP_003402100.1.66961 WP_003402100.1.67005 WP_003402100.1.6704 WP_003402100.1.67044 WP_003402100.1.67061 WP_003402100.1.67098 WP_003402100.1.67146 WP_003402100.1.67197 WP_003402100.1.6720 WP_003402100.1.67207 WP_003402100.1.67218 WP_003402100.1.67220 WP_003402100.1.67225 WP_003402100.1.67231 WP_003402100.1.6724 WP_003402100.1.67257 WP_003402100.1.67298 WP_003402100.1.67307 WP_003402100.1.67324 WP_003402100.1.67332 WP_003402100.1.67346 WP_003402100.1.67360 WP_003402100.1.67381 WP_003402100.1.67396 WP_003402100.1.67417 WP_003402100.1.67422 WP_003402100.1.67453 WP_003402100.1.67459 WP_003402100.1.6746 WP_003402100.1.67473 WP_003402100.1.67482 WP_003402100.1.67496 WP_003402100.1.67499 WP_003402100.1.67523 WP_003402100.1.67536 WP_003402100.1.67575 WP_003402100.1.67587 WP_003402100.1.67598 WP_003402100.1.67600 WP_003402100.1.67602 WP_003402100.1.67679 WP_003402100.1.67692 WP_003402100.1.67744 WP_003402100.1.6775 WP_003402100.1.67750 WP_003402100.1.6777 WP_003402100.1.67809 WP_003402100.1.67816 WP_003402100.1.67844 WP_003402100.1.67848 WP_003402100.1.67870 WP_003402100.1.67888 WP_003402100.1.67915 WP_003402100.1.67945 WP_003402100.1.67949 WP_003402100.1.67980 WP_003402100.1.67982 WP_003402100.1.68022 WP_003402100.1.68029 WP_003402100.1.68037 WP_003402100.1.68038 WP_003402100.1.68045 WP_003402100.1.68057 WP_003402100.1.68083 WP_003402100.1.68088 WP_003402100.1.68106 WP_003402100.1.68110 WP_003402100.1.68153 WP_003402100.1.68164 WP_003402100.1.68169 WP_003402100.1.68193 WP_003402100.1.68212 WP_003402100.1.68227 WP_003402100.1.68243 WP_003402100.1.6825 WP_003402100.1.68297 WP_003402100.1.68309 WP_003402100.1.68325 WP_003402100.1.68329 WP_003402100.1.68340 WP_003402100.1.68384 WP_003402100.1.68388 WP_003402100.1.68429 WP_003402100.1.6843 WP_003402100.1.68433 WP_003402100.1.68444 WP_003402100.1.68465 WP_003402100.1.68518 WP_003402100.1.68569 WP_003402100.1.68576 WP_003402100.1.68580 WP_003402100.1.68586 WP_003402100.1.68623 WP_003402100.1.68624 WP_003402100.1.68637 WP_003402100.1.68646 WP_003402100.1.68667 WP_003402100.1.68669 WP_003402100.1.68672 WP_003402100.1.68684 WP_003402100.1.68704 WP_003402100.1.68708 WP_003402100.1.6872 WP_003402100.1.68730 WP_003402100.1.68734 WP_003402100.1.68748 WP_003402100.1.68754 WP_003402100.1.6876 WP_003402100.1.68761 WP_003402100.1.68763 WP_003402100.1.68766 WP_003402100.1.68774 WP_003402100.1.68796 WP_003402100.1.68824 WP_003402100.1.68832 WP_003402100.1.68833 WP_003402100.1.68841 WP_003402100.1.68859 WP_003402100.1.68876 WP_003402100.1.68906 WP_003402100.1.68923 WP_003402100.1.68945 WP_003402100.1.6896 WP_003402100.1.68981 WP_003402100.1.68984 WP_003402100.1.68997 WP_003402100.1.69008 WP_003402100.1.69076 WP_003402100.1.69079 WP_003402100.1.6908 WP_003402100.1.69082 WP_003402100.1.69178 WP_003402100.1.69181 WP_003402100.1.69208 WP_003402100.1.69231 WP_003402100.1.69256 WP_003402100.1.69311 WP_003402100.1.69315 WP_003402100.1.69322 WP_003402100.1.69342 WP_003402100.1.6935 WP_003402100.1.6936 WP_003402100.1.69369 WP_003402100.1.69374 WP_003402100.1.69398 WP_003402100.1.69401 WP_003402100.1.69426 WP_003402100.1.69427 WP_003402100.1.69429 WP_003402100.1.6949 WP_003402100.1.6951 WP_003402100.1.69511 WP_003402100.1.69526 WP_003402100.1.69528 WP_003402100.1.69547 WP_003402100.1.69573 WP_003402100.1.69581 WP_003402100.1.6960 WP_003402100.1.69617 WP_003402100.1.69634 WP_003402100.1.69647 WP_003402100.1.69659 WP_003402100.1.69673 WP_003402100.1.69682 WP_003402100.1.69684 WP_003402100.1.69686 WP_003402100.1.69707 WP_003402100.1.69709 WP_003402100.1.69723 WP_003402100.1.69736 WP_003402100.1.69778 WP_003402100.1.69800 WP_003402100.1.69802 WP_003402100.1.69845 WP_003402100.1.69870 WP_003402100.1.69873 WP_003402100.1.69898 WP_003402100.1.69913 WP_003402100.1.69925 WP_003402100.1.69931 WP_003402100.1.69938 WP_003402100.1.69955 WP_003402100.1.69957 WP_003402100.1.69981 WP_003402100.1.69990 WP_003402100.1.70 WP_003402100.1.70000 WP_003402100.1.70017 WP_003402100.1.70032 WP_003402100.1.70055 WP_003402100.1.70062 WP_003402100.1.70072 WP_003402100.1.70131 WP_003402100.1.70132 WP_003402100.1.7022 WP_003402100.1.70227 WP_003402100.1.70255 WP_003402100.1.70271 WP_003402100.1.70274 WP_003402100.1.7029 WP_003402100.1.70325 WP_003402100.1.70328 WP_003402100.1.70356 WP_003402100.1.70364 WP_003402100.1.70368 WP_003402100.1.70369 WP_003402100.1.70418 WP_003402100.1.70422 WP_003402100.1.70435 WP_003402100.1.70444 WP_003402100.1.70463 WP_003402100.1.70471 WP_003402100.1.70480 WP_003402100.1.70494 WP_003402100.1.70498 WP_003402100.1.70525 WP_003402100.1.70573 WP_003402100.1.70577 WP_003402100.1.70610 WP_003402100.1.70615 WP_003402100.1.70618 WP_003402100.1.70622 WP_003402100.1.70626 WP_003402100.1.70668 WP_003402100.1.70699 WP_003402100.1.70704 WP_003402100.1.70729 WP_003402100.1.70757 WP_003402100.1.70782 WP_003402100.1.70834 WP_003402100.1.7084 WP_003402100.1.70840 WP_003402100.1.70864 WP_003402100.1.70871 WP_003402100.1.70915 WP_003402100.1.70955 WP_003402100.1.70958 WP_003402100.1.70964 WP_003402100.1.70976 WP_003402100.1.71015 WP_003402100.1.71026 WP_003402100.1.71063 WP_003402100.1.71076 WP_003402100.1.71083 WP_003402100.1.7111 WP_003402100.1.71118 WP_003402100.1.7113 WP_003402100.1.71187 WP_003402100.1.71191 WP_003402100.1.71255 WP_003402100.1.71258 WP_003402100.1.71259 WP_003402100.1.71289 WP_003402100.1.71326 WP_003402100.1.71329 WP_003402100.1.71331 WP_003402100.1.71344 WP_003402100.1.71390 WP_003402100.1.71399 WP_003402100.1.71414 WP_003402100.1.71440 WP_003402100.1.71457 WP_003402100.1.71490 WP_003402100.1.71492 WP_003402100.1.71509 WP_003402100.1.71516 WP_003402100.1.71517 WP_003402100.1.71527 WP_003402100.1.71532 WP_003402100.1.71545 WP_003402100.1.71546 WP_003402100.1.71569 WP_003402100.1.71604 WP_003402100.1.71621 WP_003402100.1.71630 WP_003402100.1.71654 WP_003402100.1.71664 WP_003402100.1.71665 WP_003402100.1.71683 WP_003402100.1.71701 WP_003402100.1.71718 WP_003402100.1.71731 WP_003402100.1.71778 WP_003402100.1.71781 WP_003402100.1.71803 WP_003402100.1.71820 WP_003402100.1.71847 WP_003402100.1.7185 WP_003402100.1.71851 WP_003402100.1.71871 WP_003402100.1.71909 WP_003402100.1.71957 WP_003402100.1.71970 WP_003402100.1.72047 WP_003402100.1.72061 WP_003402100.1.72062 WP_003402100.1.72072 WP_003402100.1.72111 WP_003402100.1.72122 WP_003402100.1.72143 WP_003402100.1.7216 WP_003402100.1.72168 WP_003402100.1.72179 WP_003402100.1.72209 WP_003402100.1.72218 WP_003402100.1.72219 WP_003402100.1.72227 WP_003402100.1.7224 WP_003402100.1.72268 WP_003402100.1.72332 WP_003402100.1.72380 WP_003402100.1.72401 WP_003402100.1.72405 WP_003402100.1.72420 WP_003402100.1.72441 WP_003402100.1.72451 WP_003402100.1.72452 WP_003402100.1.72457 WP_003402100.1.72459 WP_003402100.1.72460 WP_003402100.1.72466 WP_003402100.1.72487 WP_003402100.1.72488 WP_003402100.1.72492 WP_003402100.1.72506 WP_003402100.1.72543 WP_003402100.1.7256 WP_003402100.1.72576 WP_003402100.1.72578 WP_003402100.1.72585 WP_003402100.1.72591 WP_003402100.1.72592 WP_003402100.1.72640 WP_003402100.1.7266 WP_003402100.1.72661 WP_003402100.1.72739 WP_003402100.1.72744 WP_003402100.1.72755 WP_003402100.1.72759 WP_003402100.1.72784 WP_003402100.1.72792 WP_003402100.1.72826 WP_003402100.1.72831 WP_003402100.1.72852 WP_003402100.1.72853 WP_003402100.1.72879 WP_003402100.1.72880 WP_003402100.1.72938 WP_003402100.1.72954 WP_003402100.1.72957 WP_003402100.1.72959 WP_003402100.1.72973 WP_003402100.1.7298 WP_003402100.1.72982 WP_003402100.1.72988 WP_003402100.1.72993 WP_003402100.1.73006 WP_003402100.1.73013 WP_003402100.1.73025 WP_003402100.1.73028 WP_003402100.1.73042 WP_003402100.1.73045 WP_003402100.1.73092 WP_003402100.1.73118 WP_003402100.1.7312 WP_003402100.1.73127 WP_003402100.1.73134 WP_003402100.1.73150 WP_003402100.1.73154 WP_003402100.1.73163 WP_003402100.1.73182 WP_003402100.1.73205 WP_003402100.1.7321 WP_003402100.1.73310 WP_003402100.1.73365 WP_003402100.1.73391 WP_003402100.1.73404 WP_003402100.1.73424 WP_003402100.1.73436 WP_003402100.1.73445 WP_003402100.1.73453 WP_003402100.1.73465 WP_003402100.1.73466 WP_003402100.1.73470 WP_003402100.1.73471 WP_003402100.1.73478 WP_003402100.1.73482 WP_003402100.1.73507 WP_003402100.1.73532 WP_003402100.1.73550 WP_003402100.1.73564 WP_003402100.1.73623 WP_003402100.1.73629 WP_003402100.1.73644 WP_003402100.1.7368 WP_003402100.1.73688 WP_003402100.1.73723 WP_003402100.1.73744 WP_003402100.1.73750 WP_003402100.1.73760 WP_003402100.1.73774 WP_003402100.1.7379 WP_003402100.1.73813 WP_003402100.1.73840 WP_003402100.1.7389 WP_003402100.1.73986 WP_003402100.1.74016 WP_003402100.1.74039 WP_003402100.1.74083 WP_003402100.1.74101 WP_003402100.1.74107 WP_003402100.1.74129 WP_003402100.1.74144 WP_003402100.1.7417 WP_003402100.1.74190 WP_003402100.1.74210 WP_003402100.1.7423 WP_003402100.1.74259 WP_003402100.1.74262 WP_003402100.1.74269 WP_003402100.1.74282 WP_003402100.1.74291 WP_003402100.1.74296 WP_003402100.1.74304 WP_003402100.1.7432 WP_003402100.1.74347 WP_003402100.1.7436 WP_003402100.1.74378 WP_003402100.1.74382 WP_003402100.1.74395 WP_003402100.1.74400 WP_003402100.1.74432 WP_003402100.1.74442 WP_003402100.1.74477 WP_003402100.1.74487 WP_003402100.1.74499 WP_003402100.1.74504 WP_003402100.1.74511 WP_003402100.1.74523 WP_003402100.1.74525 WP_003402100.1.74551 WP_003402100.1.74555 WP_003402100.1.74628 WP_003402100.1.74641 WP_003402100.1.74653 WP_003402100.1.74660 WP_003402100.1.74683 WP_003402100.1.7469 WP_003402100.1.74725 WP_003402100.1.74760 WP_003402100.1.74809 WP_003402100.1.74820 WP_003402100.1.74870 WP_003402100.1.74881 WP_003402100.1.74888 WP_003402100.1.7496 WP_003402100.1.74988 WP_003402100.1.75043 WP_003402100.1.75078 WP_003402100.1.75081 WP_003402100.1.75120 WP_003402100.1.75163 WP_003402100.1.75188 WP_003402100.1.75200 WP_003402100.1.75202 WP_003402100.1.75234 WP_003402100.1.75239 WP_003402100.1.75263 WP_003402100.1.75342 WP_003402100.1.7535 WP_003402100.1.75376 WP_003402100.1.75391 WP_003402100.1.75395 WP_003402100.1.75441 WP_003402100.1.75510 WP_003402100.1.75581 WP_003402100.1.75598 WP_003402100.1.75635 WP_003402100.1.75645 WP_003402100.1.75665 WP_003402100.1.75671 WP_003402100.1.75741 WP_003402100.1.75749 WP_003402100.1.75772 WP_003402100.1.75774 WP_003402100.1.75833 WP_003402100.1.7585 WP_003402100.1.75868 WP_003402100.1.75878 WP_003402100.1.75927 WP_003402100.1.75946 WP_003402100.1.75968 WP_003402100.1.75974 WP_003402100.1.76007 WP_003402100.1.76032 WP_003402100.1.76037 WP_003402100.1.7604 WP_003402100.1.76045 WP_003402100.1.76052 WP_003402100.1.76058 WP_003402100.1.76064 WP_003402100.1.76110 WP_003402100.1.76126 WP_003402100.1.76133 WP_003402100.1.76138 WP_003402100.1.76157 WP_003402100.1.76172 WP_003402100.1.76177 WP_003402100.1.76183 WP_003402100.1.76209 WP_003402100.1.76272 WP_003402100.1.76277 WP_003402100.1.76280 WP_003402100.1.76281 WP_003402100.1.76291 WP_003402100.1.76297 WP_003402100.1.76379 WP_003402100.1.76403 WP_003402100.1.76413 WP_003402100.1.76414 WP_003402100.1.76427 WP_003402100.1.76436 WP_003402100.1.76442 WP_003402100.1.76443 WP_003402100.1.76456 WP_003402100.1.76521 WP_003402100.1.76533 WP_003402100.1.76616 WP_003402100.1.76625 WP_003402100.1.76629 WP_003402100.1.76635 WP_003402100.1.76638 WP_003402100.1.76639 WP_003402100.1.76640 WP_003402100.1.76644 WP_003402100.1.76677 WP_003402100.1.76678 WP_003402100.1.76679 WP_003402100.1.76734 WP_003402100.1.76744 WP_003402100.1.76754 WP_003402100.1.76757 WP_003402100.1.76781 WP_003402100.1.76818 WP_003402100.1.76824 WP_003402100.1.76835 WP_003402100.1.76873 WP_003402100.1.76881 WP_003402100.1.76888 WP_003402100.1.76900 WP_003402100.1.7691 WP_003402100.1.76947 WP_003402100.1.76954 WP_003402100.1.76955 WP_003402100.1.76963 WP_003402100.1.76976 WP_003402100.1.770 WP_003402100.1.77000 WP_003402100.1.77008 WP_003402100.1.77021 WP_003402100.1.77056 WP_003402100.1.77065 WP_003402100.1.77075 WP_003402100.1.77093 WP_003402100.1.77107 WP_003402100.1.77115 WP_003402100.1.77118 WP_003402100.1.77125 WP_003402100.1.77141 WP_003402100.1.77142 WP_003402100.1.77166 WP_003402100.1.77260 WP_003402100.1.77266 WP_003402100.1.77285 WP_003402100.1.77312 WP_003402100.1.77348 WP_003402100.1.77351 WP_003402100.1.77352 WP_003402100.1.77361 WP_003402100.1.774 WP_003402100.1.77404 WP_003402100.1.77425 WP_003402100.1.77463 WP_003402100.1.77474 WP_003402100.1.7748 WP_003402100.1.77491 WP_003402100.1.77499 WP_003402100.1.77510 WP_003402100.1.77530 WP_003402100.1.77554 WP_003402100.1.77559 WP_003402100.1.7762 WP_003402100.1.77627 WP_003402100.1.77649 WP_003402100.1.77654 WP_003402100.1.7766 WP_003402100.1.77667 WP_003402100.1.77704 WP_003402100.1.77706 WP_003402100.1.77726 WP_003402100.1.77774 WP_003402100.1.7778 WP_003402100.1.77790 WP_003402100.1.77809 WP_003402100.1.77820 WP_003402100.1.77843 WP_003402100.1.77855 WP_003402100.1.77865 WP_003402100.1.77868 WP_003402100.1.77879 WP_003402100.1.77890 WP_003402100.1.77909 WP_003402100.1.77911 WP_003402100.1.77931 WP_003402100.1.77984 WP_003402100.1.78020 WP_003402100.1.78024 WP_003402100.1.78075 WP_003402100.1.78084 WP_003402100.1.78086 WP_003402100.1.7809 WP_003402100.1.78098 WP_003402100.1.78105 WP_003402100.1.78113 WP_003402100.1.78136 WP_003402100.1.78162 WP_003402100.1.7817 WP_003402100.1.78200 WP_003402100.1.78216 WP_003402100.1.78236 WP_003402100.1.78238 WP_003402100.1.78322 WP_003402100.1.78338 WP_003402100.1.78360 WP_003402100.1.78386 WP_003402100.1.78429 WP_003402100.1.78435 WP_003402100.1.7844 WP_003402100.1.78459 WP_003402100.1.78488 WP_003402100.1.7849 WP_003402100.1.78499 WP_003402100.1.785 WP_003402100.1.78516 WP_003402100.1.78524 WP_003402100.1.78526 WP_003402100.1.78538 WP_003402100.1.78544 WP_003402100.1.78545 WP_003402100.1.78547 WP_003402100.1.78574 WP_003402100.1.78580 WP_003402100.1.7860 WP_003402100.1.78620 WP_003402100.1.78646 WP_003402100.1.78648 WP_003402100.1.78649 WP_003402100.1.78655 WP_003402100.1.78657 WP_003402100.1.78659 WP_003402100.1.7869 WP_003402100.1.78692 WP_003402100.1.78760 WP_003402100.1.78766 WP_003402100.1.78776 WP_003402100.1.78778 WP_003402100.1.78784 WP_003402100.1.78788 WP_003402100.1.78790 WP_003402100.1.78793 WP_003402100.1.78848 WP_003402100.1.78860 WP_003402100.1.7887 WP_003402100.1.78884 WP_003402100.1.78932 WP_003402100.1.78969 WP_003402100.1.78977 WP_003402100.1.78980 WP_003402100.1.79005 WP_003402100.1.79016 WP_003402100.1.79033 WP_003402100.1.79064 WP_003402100.1.79068 WP_003402100.1.79095 WP_003402100.1.79112 WP_003402100.1.79122 WP_003402100.1.79145 WP_003402100.1.79152 WP_003402100.1.79163 WP_003402100.1.79213 WP_003402100.1.79218 WP_003402100.1.79268 WP_003402100.1.79273 WP_003402100.1.79278 WP_003402100.1.79290 WP_003402100.1.79319 WP_003402100.1.79325 WP_003402100.1.79326 WP_003402100.1.7933 WP_003402100.1.79339 WP_003402100.1.79394 WP_003402100.1.79399 WP_003402100.1.79413 WP_003402100.1.79422 WP_003402100.1.79445 WP_003402100.1.79447 WP_003402100.1.79455 WP_003402100.1.79471 WP_003402100.1.79480 WP_003402100.1.79482 WP_003402100.1.79488 WP_003402100.1.79500 WP_003402100.1.79508 WP_003402100.1.79514 WP_003402100.1.79561 WP_003402100.1.79565 WP_003402100.1.79578 WP_003402100.1.79588 WP_003402100.1.79598 WP_003402100.1.79615 WP_003402100.1.79684 WP_003402100.1.79698 WP_003402100.1.797 WP_003402100.1.79744 WP_003402100.1.79784 WP_003402100.1.79806 WP_003402100.1.79819 WP_003402100.1.79826 WP_003402100.1.79828 WP_003402100.1.79851 WP_003402100.1.79853 WP_003402100.1.79863 WP_003402100.1.79881 WP_003402100.1.79885 WP_003402100.1.79898 WP_003402100.1.7990 WP_003402100.1.79900 WP_003402100.1.79913 WP_003402100.1.79918 WP_003402100.1.79947 WP_003402100.1.79948 WP_003402100.1.7995 WP_003402100.1.7997 WP_003402100.1.80004 WP_003402100.1.80022 WP_003402100.1.80030 WP_003402100.1.80054 WP_003402100.1.80084 WP_003402100.1.80099 WP_003402100.1.80129 WP_003402100.1.80177 WP_003402100.1.80234 WP_003402100.1.8026 WP_003402100.1.80275 WP_003402100.1.8029 WP_003402100.1.80299 WP_003402100.1.80304 WP_003402100.1.80326 WP_003402100.1.80351 WP_003402100.1.8037 WP_003402100.1.80370 WP_003402100.1.80387 WP_003402100.1.80399 WP_003402100.1.8044 WP_003402100.1.80451 WP_003402100.1.80458 WP_003402100.1.80461 WP_003402100.1.80490 WP_003402100.1.80503 WP_003402100.1.80507 WP_003402100.1.80552 WP_003402100.1.80576 WP_003402100.1.80588 WP_003402100.1.80599 WP_003402100.1.8060 WP_003402100.1.80624 WP_003402100.1.80636 WP_003402100.1.80711 WP_003402100.1.80714 WP_003402100.1.80743 WP_003402100.1.80784 WP_003402100.1.80815 WP_003402100.1.80853 WP_003402100.1.80918 WP_003402100.1.8093 WP_003402100.1.80967 WP_003402100.1.8097 WP_003402100.1.80988 WP_003402100.1.81007 WP_003402100.1.81013 WP_003402100.1.8105 WP_003402100.1.81059 WP_003402100.1.81063 WP_003402100.1.81066 WP_003402100.1.81075 WP_003402100.1.81091 WP_003402100.1.81119 WP_003402100.1.81125 WP_003402100.1.81136 WP_003402100.1.8114 WP_003402100.1.81189 WP_003402100.1.81192 WP_003402100.1.812 WP_003402100.1.81230 WP_003402100.1.81249 WP_003402100.1.81250 WP_003402100.1.81264 WP_003402100.1.8128 WP_003402100.1.81287 WP_003402100.1.81297 WP_003402100.1.8138 WP_003402100.1.81407 WP_003402100.1.8143 WP_003402100.1.81439 WP_003402100.1.81465 WP_003402100.1.81505 WP_003402100.1.81529 WP_003402100.1.81538 WP_003402100.1.81541 WP_003402100.1.81560 WP_003402100.1.81561 WP_003402100.1.81567 WP_003402100.1.81583 WP_003402100.1.81686 WP_003402100.1.81712 WP_003402100.1.81720 WP_003402100.1.81731 WP_003402100.1.81774 WP_003402100.1.81788 WP_003402100.1.81809 WP_003402100.1.81820 WP_003402100.1.81850 WP_003402100.1.81883 WP_003402100.1.81891 WP_003402100.1.81911 WP_003402100.1.81918 WP_003402100.1.82011 WP_003402100.1.82048 WP_003402100.1.82069 WP_003402100.1.82071 WP_003402100.1.82108 WP_003402100.1.82136 WP_003402100.1.82142 WP_003402100.1.8215 WP_003402100.1.82158 WP_003402100.1.82209 WP_003402100.1.82210 WP_003402100.1.82228 WP_003402100.1.82236 WP_003402100.1.82251 WP_003402100.1.82271 WP_003402100.1.82305 WP_003402100.1.82307 WP_003402100.1.82317 WP_003402100.1.8232 WP_003402100.1.82346 WP_003402100.1.82374 WP_003402100.1.82385 WP_003402100.1.82429 WP_003402100.1.82460 WP_003402100.1.82483 WP_003402100.1.82494 WP_003402100.1.82531 WP_003402100.1.82546 WP_003402100.1.82547 WP_003402100.1.82549 WP_003402100.1.82577 WP_003402100.1.82592 WP_003402100.1.82597 WP_003402100.1.82598 WP_003402100.1.82625 WP_003402100.1.82642 WP_003402100.1.82651 WP_003402100.1.82653 WP_003402100.1.82681 WP_003402100.1.82685 WP_003402100.1.8271 WP_003402100.1.82712 WP_003402100.1.8273 WP_003402100.1.82743 WP_003402100.1.82757 WP_003402100.1.82774 WP_003402100.1.82803 WP_003402100.1.82860 WP_003402100.1.82871 WP_003402100.1.82892 WP_003402100.1.82935 WP_003402100.1.82957 WP_003402100.1.82973 WP_003402100.1.82981 WP_003402100.1.82983 WP_003402100.1.83004 WP_003402100.1.83009 WP_003402100.1.83044 WP_003402100.1.83074 WP_003402100.1.83110 WP_003402100.1.83146 WP_003402100.1.83149 WP_003402100.1.83159 WP_003402100.1.8317 WP_003402100.1.83173 WP_003402100.1.83181 WP_003402100.1.83182 WP_003402100.1.83191 WP_003402100.1.83197 WP_003402100.1.83212 WP_003402100.1.8326 WP_003402100.1.83262 WP_003402100.1.83268 WP_003402100.1.83273 WP_003402100.1.83309 WP_003402100.1.83332 WP_003402100.1.83334 WP_003402100.1.83341 WP_003402100.1.83349 WP_003402100.1.8335 WP_003402100.1.83353 WP_003402100.1.83380 WP_003402100.1.83381 WP_003402100.1.83389 WP_003402100.1.83408 WP_003402100.1.83409 WP_003402100.1.83435 WP_003402100.1.83470 WP_003402100.1.83524 WP_003402100.1.83526 WP_003402100.1.8358 WP_003402100.1.83589 WP_003402100.1.83601 WP_003402100.1.83611 WP_003402100.1.83638 WP_003402100.1.83648 WP_003402100.1.83656 WP_003402100.1.83667 WP_003402100.1.83689 WP_003402100.1.83705 WP_003402100.1.83766 WP_003402100.1.83793 WP_003402100.1.83794 WP_003402100.1.83802 WP_003402100.1.83805 WP_003402100.1.83839 WP_003402100.1.83842 WP_003402100.1.83850 WP_003402100.1.83861 WP_003402100.1.83884 WP_003402100.1.83920 WP_003402100.1.83929 WP_003402100.1.83930 WP_003402100.1.83975 WP_003402100.1.83991 WP_003402100.1.8400 WP_003402100.1.84027 WP_003402100.1.8404 WP_003402100.1.84057 WP_003402100.1.84070 WP_003402100.1.8409 WP_003402100.1.84112 WP_003402100.1.84146 WP_003402100.1.8415 WP_003402100.1.84176 WP_003402100.1.84192 WP_003402100.1.84228 WP_003402100.1.8424 WP_003402100.1.84244 WP_003402100.1.84259 WP_003402100.1.8426 WP_003402100.1.84277 WP_003402100.1.84287 WP_003402100.1.8434 WP_003402100.1.84388 WP_003402100.1.84409 WP_003402100.1.84438 WP_003402100.1.84460 WP_003402100.1.84488 WP_003402100.1.84504 WP_003402100.1.84525 WP_003402100.1.84641 WP_003402100.1.84655 WP_003402100.1.84666 WP_003402100.1.84670 WP_003402100.1.84739 WP_003402100.1.84748 WP_003402100.1.84766 WP_003402100.1.84772 WP_003402100.1.84774 WP_003402100.1.848 WP_003402100.1.84812 WP_003402100.1.84836 WP_003402100.1.84839 WP_003402100.1.84846 WP_003402100.1.84873 WP_003402100.1.84911 WP_003402100.1.84938 WP_003402100.1.84968 WP_003402100.1.84973 WP_003402100.1.84981 WP_003402100.1.84985 WP_003402100.1.8503 WP_003402100.1.85038 WP_003402100.1.85043 WP_003402100.1.8505 WP_003402100.1.85074 WP_003402100.1.8509 WP_003402100.1.8512 WP_003402100.1.85148 WP_003402100.1.8518 WP_003402100.1.8522 WP_003402100.1.85242 WP_003402100.1.85276 WP_003402100.1.85281 WP_003402100.1.85314 WP_003402100.1.85319 WP_003402100.1.85330 WP_003402100.1.85341 WP_003402100.1.8535 WP_003402100.1.85363 WP_003402100.1.85371 WP_003402100.1.85377 WP_003402100.1.85387 WP_003402100.1.85399 WP_003402100.1.85458 WP_003402100.1.8546 WP_003402100.1.85464 WP_003402100.1.85478 WP_003402100.1.85480 WP_003402100.1.85488 WP_003402100.1.85495 WP_003402100.1.85551 WP_003402100.1.85557 WP_003402100.1.85577 WP_003402100.1.85599 WP_003402100.1.85610 WP_003402100.1.8563 WP_003402100.1.85648 WP_003402100.1.85679 WP_003402100.1.85704 WP_003402100.1.85727 WP_003402100.1.85737 WP_003402100.1.85763 WP_003402100.1.85808 WP_003402100.1.85819 WP_003402100.1.85820 WP_003402100.1.85823 WP_003402100.1.85832 WP_003402100.1.8586 WP_003402100.1.85872 WP_003402100.1.85913 WP_003402100.1.85953 WP_003402100.1.85986 WP_003402100.1.86000 WP_003402100.1.86025 WP_003402100.1.86032 WP_003402100.1.86048 WP_003402100.1.86067 WP_003402100.1.86103 WP_003402100.1.86122 WP_003402100.1.86124 WP_003402100.1.86164 WP_003402100.1.86168 WP_003402100.1.86190 WP_003402100.1.86208 WP_003402100.1.86235 WP_003402100.1.86249 WP_003402100.1.86260 WP_003402100.1.86290 WP_003402100.1.863 WP_003402100.1.86327 WP_003402100.1.86334 WP_003402100.1.86337 WP_003402100.1.86368 WP_003402100.1.86377 WP_003402100.1.86425 WP_003402100.1.86459 WP_003402100.1.8649 WP_003402100.1.86499 WP_003402100.1.86520 WP_003402100.1.86561 WP_003402100.1.86568 WP_003402100.1.86575 WP_003402100.1.86584 WP_003402100.1.86605 WP_003402100.1.86626 WP_003402100.1.86648 WP_003402100.1.8666 WP_003402100.1.86684 WP_003402100.1.86696 WP_003402100.1.86705 WP_003402100.1.86718 WP_003402100.1.86725 WP_003402100.1.86757 WP_003402100.1.86766 WP_003402100.1.86801 WP_003402100.1.86814 WP_003402100.1.86820 WP_003402100.1.86825 WP_003402100.1.86834 WP_003402100.1.8685 WP_003402100.1.86851 WP_003402100.1.86855 WP_003402100.1.86867 WP_003402100.1.86877 WP_003402100.1.86883 WP_003402100.1.8689 WP_003402100.1.86892 WP_003402100.1.86941 WP_003402100.1.86950 WP_003402100.1.86962 WP_003402100.1.86963 WP_003402100.1.86979 WP_003402100.1.8700 WP_003402100.1.87001 WP_003402100.1.87002 WP_003402100.1.87031 WP_003402100.1.87116 WP_003402100.1.87117 WP_003402100.1.8714 WP_003402100.1.87178 WP_003402100.1.87191 WP_003402100.1.87201 WP_003402100.1.87209 WP_003402100.1.87240 WP_003402100.1.87266 WP_003402100.1.87273 WP_003402100.1.87275 WP_003402100.1.8733 WP_003402100.1.87345 WP_003402100.1.87369 WP_003402100.1.8737 WP_003402100.1.87401 WP_003402100.1.87406 WP_003402100.1.87409 WP_003402100.1.87444 WP_003402100.1.87459 WP_003402100.1.87472 WP_003402100.1.87489 WP_003402100.1.87494 WP_003402100.1.87496 WP_003402100.1.87582 WP_003402100.1.87588 WP_003402100.1.87617 WP_003402100.1.87619 WP_003402100.1.87620 WP_003402100.1.87634 WP_003402100.1.87643 WP_003402100.1.8765 WP_003402100.1.87650 WP_003402100.1.87654 WP_003402100.1.87658 WP_003402100.1.87665 WP_003402100.1.87676 WP_003402100.1.87677 WP_003402100.1.87684 WP_003402100.1.87692 WP_003402100.1.87707 WP_003402100.1.87732 WP_003402100.1.87784 WP_003402100.1.87796 WP_003402100.1.87809 WP_003402100.1.87817 WP_003402100.1.87827 WP_003402100.1.87831 WP_003402100.1.87835 WP_003402100.1.87837 WP_003402100.1.87866 WP_003402100.1.8789 WP_003402100.1.87911 WP_003402100.1.87924 WP_003402100.1.87951 WP_003402100.1.87956 WP_003402100.1.87991 WP_003402100.1.88 WP_003402100.1.88002 WP_003402100.1.88037 WP_003402100.1.88039 WP_003402100.1.88072 WP_003402100.1.88077 WP_003402100.1.88121 WP_003402100.1.88191 WP_003402100.1.88205 WP_003402100.1.88217 WP_003402100.1.88219 WP_003402100.1.88245 WP_003402100.1.88253 WP_003402100.1.88294 WP_003402100.1.88315 WP_003402100.1.88316 WP_003402100.1.88320 WP_003402100.1.8840 WP_003402100.1.88437 WP_003402100.1.88453 WP_003402100.1.88469 WP_003402100.1.88489 WP_003402100.1.88507 WP_003402100.1.88530 WP_003402100.1.88537 WP_003402100.1.88592 WP_003402100.1.88616 WP_003402100.1.88618 WP_003402100.1.8862 WP_003402100.1.88625 WP_003402100.1.88632 WP_003402100.1.88634 WP_003402100.1.88649 WP_003402100.1.88737 WP_003402100.1.88756 WP_003402100.1.888 WP_003402100.1.88824 WP_003402100.1.88886 WP_003402100.1.88965 WP_003402100.1.88985 WP_003402100.1.8902 WP_003402100.1.89025 WP_003402100.1.89041 WP_003402100.1.89046 WP_003402100.1.89082 WP_003402100.1.89162 WP_003402100.1.8917 WP_003402100.1.89205 WP_003402100.1.89207 WP_003402100.1.89225 WP_003402100.1.8925 WP_003402100.1.89277 WP_003402100.1.89286 WP_003402100.1.89293 WP_003402100.1.89320 WP_003402100.1.8935 WP_003402100.1.89371 WP_003402100.1.89378 WP_003402100.1.89406 WP_003402100.1.8943 WP_003402100.1.89451 WP_003402100.1.89453 WP_003402100.1.89473 WP_003402100.1.89475 WP_003402100.1.89483 WP_003402100.1.895 WP_003402100.1.89513 WP_003402100.1.89517 WP_003402100.1.89522 WP_003402100.1.8954 WP_003402100.1.89543 WP_003402100.1.89567 WP_003402100.1.8957 WP_003402100.1.89572 WP_003402100.1.89589 WP_003402100.1.89607 WP_003402100.1.89613 WP_003402100.1.89625 WP_003402100.1.89648 WP_003402100.1.8967 WP_003402100.1.89670 WP_003402100.1.89676 WP_003402100.1.89729 WP_003402100.1.89739 WP_003402100.1.89762 WP_003402100.1.8977 WP_003402100.1.89802 WP_003402100.1.89808 WP_003402100.1.8982 WP_003402100.1.89829 WP_003402100.1.89831 WP_003402100.1.89844 WP_003402100.1.89849 WP_003402100.1.8989 WP_003402100.1.89901 WP_003402100.1.89903 WP_003402100.1.89909 WP_003402100.1.8992 WP_003402100.1.89922 WP_003402100.1.89926 WP_003402100.1.89963 WP_003402100.1.89971 WP_003402100.1.8998 WP_003402100.1.89987 WP_003402100.1.900 WP_003402100.1.90048 WP_003402100.1.9007 WP_003402100.1.90080 WP_003402100.1.90130 WP_003402100.1.90134 WP_003402100.1.90137 WP_003402100.1.90157 WP_003402100.1.90184 WP_003402100.1.90199 WP_003402100.1.90231 WP_003402100.1.90245 WP_003402100.1.90308 WP_003402100.1.90322 WP_003402100.1.90328 WP_003402100.1.90481 WP_003402100.1.90499 WP_003402100.1.9050 WP_003402100.1.90527 WP_003402100.1.90550 WP_003402100.1.90560 WP_003402100.1.90612 WP_003402100.1.90640 WP_003402100.1.90672 WP_003402100.1.90687 WP_003402100.1.90691 WP_003402100.1.90711 WP_003402100.1.90722 WP_003402100.1.90744 WP_003402100.1.9075 WP_003402100.1.90756 WP_003402100.1.90767 WP_003402100.1.90771 WP_003402100.1.90785 WP_003402100.1.90800 WP_003402100.1.90810 WP_003402100.1.90816 WP_003402100.1.90819 WP_003402100.1.9082 WP_003402100.1.90884 WP_003402100.1.90899 WP_003402100.1.90906 WP_003402100.1.90958 WP_003402100.1.90977 WP_003402100.1.90987 WP_003402100.1.9102 WP_003402100.1.91026 WP_003402100.1.91032 WP_003402100.1.91053 WP_003402100.1.91082 WP_003402100.1.91106 WP_003402100.1.91112 WP_003402100.1.91144 WP_003402100.1.91151 WP_003402100.1.91157 WP_003402100.1.91167 WP_003402100.1.91169 WP_003402100.1.91192 WP_003402100.1.91201 WP_003402100.1.91207 WP_003402100.1.91208 WP_003402100.1.91211 WP_003402100.1.91214 WP_003402100.1.91230 WP_003402100.1.91244 WP_003402100.1.91251 WP_003402100.1.9128 WP_003402100.1.91284 WP_003402100.1.91294 WP_003402100.1.91303 WP_003402100.1.91322 WP_003402100.1.91386 WP_003402100.1.9139 WP_003402100.1.91398 WP_003402100.1.91411 WP_003402100.1.91430 WP_003402100.1.91436 WP_003402100.1.91483 WP_003402100.1.91496 WP_003402100.1.91508 WP_003402100.1.91576 WP_003402100.1.91589 WP_003402100.1.91694 WP_003402100.1.91695 WP_003402100.1.91713 WP_003402100.1.91716 WP_003402100.1.91717 WP_003402100.1.91728 WP_003402100.1.91759 WP_003402100.1.91784 WP_003402100.1.91785 WP_003402100.1.91786 WP_003402100.1.91802 WP_003402100.1.91822 WP_003402100.1.91828 WP_003402100.1.9189 WP_003402100.1.91896 WP_003402100.1.9190 WP_003402100.1.91915 WP_003402100.1.91931 WP_003402100.1.91937 WP_003402100.1.91944 WP_003402100.1.91953 WP_003402100.1.91957 WP_003402100.1.91976 WP_003402100.1.92021 WP_003402100.1.92083 WP_003402100.1.92127 WP_003402100.1.92144 WP_003402100.1.92150 WP_003402100.1.92153 WP_003402100.1.92190 WP_003402100.1.92192 WP_003402100.1.92200 WP_003402100.1.92220 WP_003402100.1.92221 WP_003402100.1.92222 WP_003402100.1.92273 WP_003402100.1.92289 WP_003402100.1.9229 WP_003402100.1.92294 WP_003402100.1.92300 WP_003402100.1.92317 WP_003402100.1.92334 WP_003402100.1.92338 WP_003402100.1.92345 WP_003402100.1.92356 WP_003402100.1.92364 WP_003402100.1.92380 WP_003402100.1.92428 WP_003402100.1.92447 WP_003402100.1.92456 WP_003402100.1.92467 WP_003402100.1.92471 WP_003402100.1.92490 WP_003402100.1.92508 WP_003402100.1.9251 WP_003402100.1.92511 WP_003402100.1.92523 WP_003402100.1.92527 WP_003402100.1.92536 WP_003402100.1.92592 WP_003402100.1.92603 WP_003402100.1.92606 WP_003402100.1.92610 WP_003402100.1.92613 WP_003402100.1.9263 WP_003402100.1.9265 WP_003402100.1.92650 WP_003402100.1.92660 WP_003402100.1.92677 WP_003402100.1.92685 WP_003402100.1.92689 WP_003402100.1.92690 WP_003402100.1.92714 WP_003402100.1.92736 WP_003402100.1.9274 WP_003402100.1.92752 WP_003402100.1.92760 WP_003402100.1.92777 WP_003402100.1.92803 WP_003402100.1.92833 WP_003402100.1.92856 WP_003402100.1.92892 WP_003402100.1.92907 WP_003402100.1.92908 WP_003402100.1.9291 WP_003402100.1.92917 WP_003402100.1.92996 WP_003402100.1.93006 WP_003402100.1.93008 WP_003402100.1.93009 WP_003402100.1.93015 WP_003402100.1.93043 WP_003402100.1.9307 WP_003402100.1.93083 WP_003402100.1.93097 WP_003402100.1.93137 WP_003402100.1.93192 WP_003402100.1.93199 WP_003402100.1.93203 WP_003402100.1.93212 WP_003402100.1.93234 WP_003402100.1.93245 WP_003402100.1.93257 WP_003402100.1.93265 WP_003402100.1.93297 WP_003402100.1.93320 WP_003402100.1.93328 WP_003402100.1.93337 WP_003402100.1.93343 WP_003402100.1.93349 WP_003402100.1.93363 WP_003402100.1.93377 WP_003402100.1.9338 WP_003402100.1.93417 WP_003402100.1.93419 WP_003402100.1.93426 WP_003402100.1.9344 WP_003402100.1.93443 WP_003402100.1.93447 WP_003402100.1.93470 WP_003402100.1.93483 WP_003402100.1.93487 WP_003402100.1.93495 WP_003402100.1.93499 WP_003402100.1.93516 WP_003402100.1.93536 WP_003402100.1.93544 WP_003402100.1.93555 WP_003402100.1.93560 WP_003402100.1.93564 WP_003402100.1.9357 WP_003402100.1.93573 WP_003402100.1.93576 WP_003402100.1.93588 WP_003402100.1.9363 WP_003402100.1.93645 WP_003402100.1.93649 WP_003402100.1.93659 WP_003402100.1.9368 WP_003402100.1.93689 WP_003402100.1.93693 WP_003402100.1.93698 WP_003402100.1.93706 WP_003402100.1.9371 WP_003402100.1.93792 WP_003402100.1.93823 WP_003402100.1.93871 WP_003402100.1.9388 WP_003402100.1.93894 WP_003402100.1.93903 WP_003402100.1.93907 WP_003402100.1.93913 WP_003402100.1.93946 WP_003402100.1.93950 WP_003402100.1.93953 WP_003402100.1.93954 WP_003402100.1.93988 WP_003402100.1.9407 WP_003402100.1.94143 WP_003402100.1.94154 WP_003402100.1.94184 WP_003402100.1.94204 WP_003402100.1.94205 WP_003402100.1.94226 WP_003402100.1.94231 WP_003402100.1.94256 WP_003402100.1.94261 WP_003402100.1.94281 WP_003402100.1.94292 WP_003402100.1.94297 WP_003402100.1.9431 WP_003402100.1.94326 WP_003402100.1.94339 WP_003402100.1.94392 WP_003402100.1.94416 WP_003402100.1.94421 WP_003402100.1.94456 WP_003402100.1.94480 WP_003402100.1.94495 WP_003402100.1.94511 WP_003402100.1.94512 WP_003402100.1.94525 WP_003402100.1.94528 WP_003402100.1.94564 WP_003402100.1.946 WP_003402100.1.94623 WP_003402100.1.94629 WP_003402100.1.9465 WP_003402100.1.94673 WP_003402100.1.94714 WP_003402100.1.94730 WP_003402100.1.94736 WP_003402100.1.94776 WP_003402100.1.9478 WP_003402100.1.94834 WP_003402100.1.94852 WP_003402100.1.94872 WP_003402100.1.94902 WP_003402100.1.94916 WP_003402100.1.94979 WP_003402100.1.94994 WP_003402100.1.94996 WP_003402100.1.95007 WP_003402100.1.95010 WP_003402100.1.95015 WP_003402100.1.95034 WP_003402100.1.95068 WP_003402100.1.95081 WP_003402100.1.95082 WP_003402100.1.9509 WP_003402100.1.95096 WP_003402100.1.95112 WP_003402100.1.95138 WP_003402100.1.9514 WP_003402100.1.95179 WP_003402100.1.95188 WP_003402100.1.95190 WP_003402100.1.95234 WP_003402100.1.95241 WP_003402100.1.95245 WP_003402100.1.95257 WP_003402100.1.95279 WP_003402100.1.9531 WP_003402100.1.95335 WP_003402100.1.95344 WP_003402100.1.9535 WP_003402100.1.95370 WP_003402100.1.95392 WP_003402100.1.95416 WP_003402100.1.95417 WP_003402100.1.95454 WP_003402100.1.95455 WP_003402100.1.95491 WP_003402100.1.95497 WP_003402100.1.95508 WP_003402100.1.95509 WP_003402100.1.95529 WP_003402100.1.95556 WP_003402100.1.95557 WP_003402100.1.95565 WP_003402100.1.95578 WP_003402100.1.95580 WP_003402100.1.95585 WP_003402100.1.95643 WP_003402100.1.95679 WP_003402100.1.95685 WP_003402100.1.957 WP_003402100.1.95724 WP_003402100.1.95727 WP_003402100.1.95730 WP_003402100.1.95735 WP_003402100.1.95758 WP_003402100.1.95772 WP_003402100.1.95797 WP_003402100.1.95839 WP_003402100.1.9585 WP_003402100.1.9590 WP_003402100.1.95902 WP_003402100.1.95908 WP_003402100.1.95924 WP_003402100.1.95926 WP_003402100.1.95953 WP_003402100.1.95958 WP_003402100.1.95964 WP_003402100.1.95973 WP_003402100.1.96006 WP_003402100.1.9602 WP_003402100.1.96036 WP_003402100.1.96062 WP_003402100.1.96065 WP_003402100.1.96098 WP_003402100.1.96146 WP_003402100.1.96166 WP_003402100.1.96171 WP_003402100.1.96182 WP_003402100.1.96204 WP_003402100.1.96230 WP_003402100.1.96235 WP_003402100.1.96242 WP_003402100.1.96245 WP_003402100.1.96254 WP_003402100.1.96259 WP_003402100.1.96286 WP_003402100.1.96313 WP_003402100.1.96318 WP_003402100.1.96345 WP_003402100.1.96360 WP_003402100.1.96373 WP_003402100.1.96456 WP_003402100.1.96486 WP_003402100.1.96560 WP_003402100.1.96569 WP_003402100.1.96573 WP_003402100.1.96575 WP_003402100.1.96576 WP_003402100.1.96611 WP_003402100.1.96621 WP_003402100.1.9667 WP_003402100.1.96681 WP_003402100.1.96726 WP_003402100.1.96733 WP_003402100.1.96742 WP_003402100.1.96754 WP_003402100.1.9678 WP_003402100.1.9685 WP_003402100.1.97008 WP_003402100.1.97009 WP_003402100.1.97056 WP_003402100.1.97084 WP_003402100.1.97087 WP_003402100.1.97094 WP_003402100.1.97096 WP_003402100.1.97099 WP_003402100.1.97108 WP_003402100.1.97113 WP_003402100.1.97122 WP_003402100.1.97127 WP_003402100.1.97129 WP_003402100.1.97136 WP_003402100.1.9716 WP_003402100.1.97176 WP_003402100.1.97222 WP_003402100.1.97237 WP_003402100.1.97242 WP_003402100.1.97270 WP_003402100.1.97283 WP_003402100.1.97296 WP_003402100.1.97321 WP_003402100.1.97325 WP_003402100.1.97366 WP_003402100.1.97376 WP_003402100.1.97380 WP_003402100.1.97462 WP_003402100.1.97517 WP_003402100.1.97519 WP_003402100.1.97535 WP_003402100.1.97540 WP_003402100.1.97545 WP_003402100.1.97546 WP_003402100.1.97550 WP_003402100.1.97568 WP_003402100.1.97577 WP_003402100.1.97584 WP_003402100.1.9759 WP_003402100.1.97591 WP_003402100.1.97596 WP_003402100.1.97609 WP_003402100.1.97618 WP_003402100.1.9763 WP_003402100.1.97669 WP_003402100.1.97673 WP_003402100.1.97700 WP_003402100.1.97701 WP_003402100.1.9773 WP_003402100.1.97730 WP_003402100.1.97740 WP_003402100.1.97751 WP_003402100.1.97754 WP_003402100.1.97797 WP_003402100.1.9782 WP_003402100.1.9784 WP_003402100.1.97888 WP_003402100.1.9790 WP_003402100.1.9795 WP_003402100.1.97951 WP_003402100.1.97958 WP_003402100.1.97966 WP_003402100.1.97977 WP_003402100.1.97979 WP_003402100.1.97995 WP_003402100.1.98018 WP_003402100.1.98034 WP_003402100.1.98052 WP_003402100.1.98071 WP_003402100.1.98072 WP_003402100.1.98113 WP_003402100.1.98114 WP_003402100.1.98128 WP_003402100.1.98188 WP_003402100.1.98189 WP_003402100.1.98213 WP_003402100.1.98225 WP_003402100.1.98291 WP_003402100.1.98335 WP_003402100.1.98350 WP_003402100.1.98395 WP_003402100.1.98412 WP_003402100.1.98441 WP_003402100.1.98443 WP_003402100.1.98462 WP_003402100.1.9848 WP_003402100.1.98482 WP_003402100.1.98486 WP_003402100.1.98488 WP_003402100.1.98503 WP_003402100.1.98516 WP_003402100.1.98536 WP_003402100.1.98566 WP_003402100.1.98576 WP_003402100.1.98590 WP_003402100.1.98594 WP_003402100.1.98599 WP_003402100.1.98629 WP_003402100.1.98645 WP_003402100.1.98646 WP_003402100.1.98649 WP_003402100.1.98656 WP_003402100.1.9867 WP_003402100.1.98674 WP_003402100.1.98697 WP_003402100.1.98701 WP_003402100.1.98739 WP_003402100.1.98749 WP_003402100.1.98765 WP_003402100.1.98770 WP_003402100.1.98777 WP_003402100.1.98778 WP_003402100.1.98802 WP_003402100.1.98838 WP_003402100.1.98906 WP_003402100.1.98935 WP_003402100.1.98948 WP_003402100.1.98953 WP_003402100.1.98984 WP_003402100.1.99000 WP_003402100.1.99023 WP_003402100.1.99030 WP_003402100.1.99037 WP_003402100.1.99055 WP_003402100.1.99062 WP_003402100.1.99086 WP_003402100.1.99115 WP_003402100.1.99161 WP_003402100.1.99176 WP_003402100.1.99211 WP_003402100.1.99216 WP_003402100.1.99222 WP_003402100.1.99251 WP_003402100.1.99269 WP_003402100.1.99294 WP_003402100.1.99312 WP_003402100.1.99315 WP_003402100.1.99316 WP_003402100.1.99322 WP_003402100.1.99328 WP_003402100.1.99365 WP_003402100.1.99368 WP_003402100.1.99396 WP_003402100.1.99402 WP_003402100.1.99419 WP_003402100.1.99438 WP_003402100.1.99460 WP_003402100.1.99468 WP_003402100.1.99473 WP_003402100.1.99513 WP_003402100.1.99529 WP_003402100.1.99548 WP_003402100.1.99572 WP_003402100.1.99575 WP_003402100.1.99578 WP_003402100.1.99605 WP_003402100.1.99609 WP_003402100.1.99617 WP_003402100.1.99635 WP_003402100.1.99650 WP_003402100.1.99672 WP_003402100.1.99701 WP_003402100.1.99711 WP_003402100.1.99716 WP_003402100.1.99740 WP_003402100.1.99745 WP_003402100.1.99749 WP_003402100.1.9976 WP_003402100.1.99798 WP_003402100.1.99817 WP_003402100.1.99832 WP_003402100.1.99847 WP_003402100.1.99852 WP_003402100.1.99886 WP_003402100.1.99897 WP_003402100.1.99899 WP_003402100.1.99915 WP_003402100.1.99982 WP_003402100.1.99991 gi|375294615|ref|YP_005098882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]