SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005247911 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MES00005247911
Domain Number - Region: 52-110
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 0.0667
Family RalF, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00005247911
Sequence length 156
Comment Putative uncharacterized protein GOS_1449607 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096683480331 SV=1
Sequence
NIYEIKWLNMMRDKLGLYGEDKDDLKLINNLLNWMQSNQTDYTNTFCYLMNINSIQDQIY
KDKDFIDWSRNWEKRILINGGSKENSIKLMRKNNPIVIPRNHKVEEALAKADKGNLDDVK
NLLDILKNPYDNQDKIEEYQMPAPPGNKKYQTYCGT
Download sequence
Identical sequences MES00005247911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]