SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00004638958 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00004638958
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000587
Family PDI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00004638958
Sequence length 164
Comment Putative uncharacterized protein GOS_392398 OS=marine metagenome Pep=JCVI_PEP_1096697273075 SV=1
Sequence
MKPAWDKLGSKYKDHASVMIVDVDCTADGAQTCQKMGVQGYPTIKYFLAGDKKGKDYQQG
RDFDAMLAFTKKTLDVEKCDVKTKKACKPNEIALIEKFDGKTSADIAEELKKRSEELKTI
KSDMKAAKLEHNTKVATWKKREAALNKGEAILKQLEQLRKKDEL
Download sequence
Identical sequences K8EP82
MES00004638958 XP_007515376.1.44737 Bathy01g00590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]