SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50365060|ref|YP_053485.1| from Mesoplasma florum L1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50365060|ref|YP_053485.1|
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000343
Family Single strand DNA-binding domain, SSB 0.013
Further Details:      
 
Domain Number 2 Region: 140-292
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000006
Family HD domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50365060|ref|YP_053485.1|
Sequence length 326
Comment cmp-binding factor-1 [Mesoplasma florum L1]
Sequence
MRKINELNNTISSTDLVVRIEKVIISTATNGSSYIILNLSDKTGRIEARKWTVTEEDKQL
LQPNAFILFKNAAVNEFRGVLQLKVSDYSVLSENDLNSYGLDVKDFFIEAPINIEKNYGE
LMSILESLTNQTYKELTIGLIKKYEKEFLTYPAAMSIHHNVKGGLFWHSFTLVKNALALK
PSYAYASIDWELLICGAILHDIGKVIEIIDPTGTDYSLQGKIIGHISIGNTELNKIAEEL
NLYKDEQGNINESLTLLQHMIIASHGKKEYGSPTEPVIIEAIMLSMFDDLDAKVFKINDE
LNKVELKTWTPRIISVDGKMFYKHKK
Download sequence
Identical sequences Q6F1M2
265311.Mfl244 gi|50365060|ref|YP_053485.1| YP_053485.1.45369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]