SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50365332|ref|YP_053757.1| from Mesoplasma florum L1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50365332|ref|YP_053757.1|
Domain Number 1 Region: 26-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 8.85e-67
Family Glycosyl hydrolases family 32 N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 334-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.04e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50365332|ref|YP_053757.1|
Sequence length 483
Comment sucrose-6-phosphate hydrolase [Mesoplasma florum L1]
Sequence
MQKEKYSLISNNDLEDIQKWHDKKQSDWYNNQFHLAGYSGSTNDPNGLTYHKGKYYIFMQ
SCPFSIQHFNKSWALYTTTDFINYNYEGLTLIPSTKYDINGVFSGSARINENDEIEIYYT
GNIKFNDVDRTAYTLKAFIDLKEKLVTKELLFEADLTKYTGHYRDPIVFEKNNQLYMLNG
AQTKDLKAMLNVYRFNGSNWENFKDIKFDEADEQNAYMLECPNYFKLDGREYVFACLEQD
APLKDGSHYVKYREVEIDNDINFTYKTSLLKIDLGFDFYAPQVFSNTGERVIMLGWLGNS
KSNPFPPELTTWSNQLTVPRDLFVKNNKLYQLPIKELDELRVNEIKGFENVYAYENGLTE
ISATDINNEFEILIKNEKNENIKISNINNKFIIDRSETTFKDDENLPPLINLDDLNVQSI
RILVDRSVMEIFINEGEHAVSVRFYINEHNKILTNLKNVKINQLKGYSYNWNNIIFKNEI
KGQ
Download sequence
Identical sequences Q6F0V0
265311.Mfl515 gi|50365332|ref|YP_053757.1| YP_053757.1.45369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]