SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50365343|ref|YP_053768.1| from Mesoplasma florum L1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50365343|ref|YP_053768.1|
Domain Number 1 Region: 29-341
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.2e-75
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000873
Further Details:      
 
Domain Number 2 Region: 343-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-16
Family Glycosyl hydrolases family 32 C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50365343|ref|YP_053768.1|
Sequence length 479
Comment sucrose-6-phosphate hydrolase [Mesoplasma florum L1]
Sequence
MKLNKETILNLITEHNQDDIKKANELVASDKYYRPTYHIAPPNGLLNDPNGLVYIDGEHY
IHYQWSPLQPYHGMKHWRLVKTKDFVNYDDLGVSVIPTEEFERTGAFSGSAFKEKDGVKI
YYTGNIEENGEMIEEVQIKADFIDEKIVNKRVVVEHDKNLFTPHVRDPKIFEYENNKYMI
FGAQCKADMLGGLVFYKTDDMEKYTFDRILKPSLDQTYGYMWECPNLDYLEGKMLFMQSS
EGWFNEENPYELNSSRNVVYTQIDKLDFENNKLNEKSILKTMDFGHDFYAPQTYWVDKKL
LMIGWLGAVDVQYPTDEYSWHSMLTIPRELSWSKEILVQKPYSEFKKNVLTKTTKKAFKE
LSVNKAIHLEFDLSDNLDIKILNEKNEFIEIKFTDKEIILDRTNQTAKVDWNFETPRKAL
RKFKNQKVEIFIDSSSIEIFADNYETIFTSRFFVKNFNKIQLNKEHEMLLSDIKEMKLK
Download sequence
Identical sequences Q6F0T9
YP_053768.1.45369 265311.Mfl526 gi|50365343|ref|YP_053768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]