SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|108885100|ref|NP_072947.2| from Mycoplasma genitalium G37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|108885100|ref|NP_072947.2|
Domain Number - Region: 53-181
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000398
Family BAR domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108885100|ref|NP_072947.2|
Sequence length 265
Comment hypothetical protein MG_280 [Mycoplasma genitalium G37]
Sequence
MVIFINRFSKTILLFFGMLVFVFLLGFGITALYFRSTAANLYVQARNSIDSSFNSAKAFA
NALANSANQFSKSSITNNLDQVKKDLEQSLQKVDEYKKNLESQNNLGNISQEKIRELDAT
KKDLENSKTQLDNFKNNLDKNGTASSSPSVKKQATADGVISAVSEFSTQAQSIVSSYEKI
KNNIPSSEQFNNYYDVTMITIVAVSGGMLAILITTIVFSFLTSKKRGLIRFSRFISTEQL
ADHVNDILDRYPDLEEEVITALDHD
Download sequence
Identical sequences P47522
WP_009885910.1.12213 WP_009885910.1.22713 WP_009885910.1.81660 WP_009885910.1.95915 gi|108885100|ref|NP_072947.2| gi|402551102|ref|YP_006599822.1| gi|402552095|ref|YP_006600813.1| 243273.MG_280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]