SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|12044948|ref|NP_072758.1| from Mycoplasma genitalium G37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|12044948|ref|NP_072758.1|
Domain Number - Region: 288-383
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00133
Family FCH domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|12044948|ref|NP_072758.1|
Sequence length 650
Comment hypothetical protein MG_096 [Mycoplasma genitalium G37]
Sequence
MKTQKNIFKVKALLLSLFSAAVTITIFALPIFANNGSKTDLGLLSKNSADFLGSSKRSLA
GFDTPFSPDNLQYLEKETDYDQNFKSFTEKFKDEKITNNQLGIVDIYNLFSGFHKSVKST
VDLMNQLQKQVEAANAIFPVDDAFVKLPKVPTELFKLVDDNVFPKLNPKGLNISDNIAAL
FERYNLKSIELKNFDLAFLRKADVIIKDKVRYNFEMQMQFQTVYVGGGNTVINLDFTLKA
QTVNFANLQDLQNTFVKVGNDLSTQLFWIPTVNKLTDNAGNDLTHIAKTVIGESFFQTNV
NLAKSVIEYDKVQPLVKQAFEERVLTPFKKEREAAKKAYEEEQRRLEEERKRQLEELRRR
EAEEKRKAEEAKRNQEKARREREAYEKSFNSFKDFKFYWLTKGKDVTKKADLIDALKTAI
ATPAYRNRTFSLLIKGFASGVERYFNANKNDKELKKLAFGEKGIQFPRADAGVNGLYMSN
FLRHELTSKAKFSLNLKDIKVENTVEDTQLYWKDNGIHLKQANPYKFNLNIKIKYNGWYN
VHWWNWLPAKILGIPTDWSGEMNLTFVVNGDLSEIVDKHDYPGTFFQFTDKNELLFTLAV
REQIKVDNNHFMGLLKSQNLHNLQLASGATKPPVVDLASYFHFVLLTEKS
Download sequence
Identical sequences P47342
WP_010869330.1.81660 gi|12044948|ref|NP_072758.1| 243273.MG_096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]