SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000000285 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000000285
Domain Number 1 Region: 216-539
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.8e-51
Family Diacylglycerol kinase-like 0.0089
Further Details:      
 
Domain Number 2 Region: 111-176
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000977
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000000285
Domain Number - Region: 52-101
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000000285   Gene: ENSMUSG00000000276   Transcript: ENSMUST00000000285
Sequence length 564
Comment pep:known chromosome:NCBIM37:11:88898896:88922062:-1 gene:ENSMUSG00000000276 transcript:ENSMUST00000000285
Sequence
MEGDQRSGPPAQSLLPDGHLVLWTLCSVLLPVFITLWCSLQRSRRQLHRRDIFRKSKHCW
RDTDLFSHPTYCCVCAQHILQGAFCDCCGLRVDEGCLKKVDKRFPCKEIMLKNDKAADAM
PHHWIRGNVPLCSYCVFCRQQCGSQPKLCDYRCIWCQKTVHDECMRGSLRSEKCDFGEFR
NLIIPPSYLTSINQMRKDKNTNYEGLASKFGKQWTPLIILANSRSGTNMGEGLLGEFKIL
LNPVQVFDVTKTPPIKALQLCTLLPYYSVRVLVCGGDGTVGWVLDAIDEMKIKGQEKYIP
EVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYNLR
KPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDL
NKKIELELDGERVELPNLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEIVGVY
GSFHCAQIQVKLANPFRIGQAHTVRLTLKCSMMPMQVDGEPWAQGPCTVTITHKTHALML
YFSGEQSDDDISSPSDHEDVKEAE
Download sequence
Identical sequences Q9R1C6
NP_062378.1.92730 ENSMUSP00000000285 ENSMUSP00000103526 ENSMUSP00000000285 ENSMUSP00000000285 10090.ENSMUSP00000000285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]