SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001155 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001155
Domain Number 1 Region: 299-584
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-71
Family Protein kinases, catalytic subunit 0.00000000814
Further Details:      
 
Domain Number 2 Region: 20-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.52e-22
Family Ras-binding domain, RBD 0.0000227
Further Details:      
 
Domain Number 3 Region: 92-144
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001155   Gene: ENSMUSG00000001127   Transcript: ENSMUST00000001155
Sequence length 604
Comment pep:known chromosome:NCBIM37:X:20425669:20437645:1 gene:ENSMUSG00000001127 transcript:ENSMUST00000001155
Sequence
MEPPRGPPVSGAEPSRAVGTVKVYLPNKQRTVVTVREGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSGGSRQQEAPSNLSVNELL
TPQGPSPFTQQRDQEHFSFPAPANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFTAQSFS
TDAAGRGGDGAPRGSPSPASVSSGRKSPHSKLPSEQRERKSLADEKKKVKNLGYRDSGYY
WEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTR
HVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHA
KNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQD
PNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIFSNCPKAM
RRLLTDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAA
RLVP
Download sequence
Identical sequences P04627
ENSMUSP00000001155 NP_033833.1.92730 XP_006527619.1.92730 XP_006527620.1.92730 ENSMUSP00000112513 10090.ENSMUSP00000001155 ENSMUSP00000001155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]