SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001258 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001258
Domain Number 1 Region: 405-611
Classification Level Classification E-value
Superfamily PUA domain-like 2.73e-79
Family SRA domain-like 0.00000000104
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.99e-19
Family Ubiquitin-related 0.0000253
Further Details:      
 
Domain Number 3 Region: 309-369
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000082
Family PHD domain 0.0039
Further Details:      
 
Domain Number 4 Region: 704-762
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000924
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001258   Gene: ENSMUSG00000001228   Transcript: ENSMUST00000001258
Sequence length 782
Comment pep:known chromosome:NCBIM37:17:56442744:56462909:1 gene:ENSMUSG00000001228 transcript:ENSMUST00000001258
Sequence
MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQMEDGHTLFD
YDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDK
TVWEDTDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMY
HVKYDDYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEIC
RKRQTRTARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQPPPALRNT
GKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECDMAFHLYCLKPPLTSVPPE
PEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGKGMACVGRTTECTIVPA
NHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNY
FTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVV
RNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKD
RTRQLGLTMQYPEGYLEALANKEKSRKRPAKALEQGPSSSKTGKSKQKSTGPTLSSPRAS
KKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGPYQIFLSKVKEAFQCICCQELV
FRPVTTVCQHNVCKDCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGS
GR
Download sequence
Identical sequences Q8VDF2
ENSMUSP00000001258 10090.ENSMUSP00000108662 NP_001104548.1.92730 NP_035061.3.92730 ENSMUSP00000001258 ENSMUSP00000108662 ENSMUSP00000001258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]