SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002765 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002765
Domain Number 1 Region: 592-859
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-81
Family Protein kinases, catalytic subunit 0.0000224
Further Details:      
 
Domain Number 2 Region: 429-547
Classification Level Classification E-value
Superfamily PH domain-like 7.78e-32
Family Pleckstrin-homology domain (PH domain) 0.0000128
Further Details:      
 
Domain Number 3 Region: 123-195
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.38e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 270-327
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.68e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002765   Gene: ENSMUSG00000002688   Transcript: ENSMUST00000002765
Sequence length 918
Comment pep:known chromosome:NCBIM37:12:51442218:51750210:-1 gene:ENSMUSG00000002688 transcript:ENSMUST00000002765
Sequence
MSVPPLLRPPSPLLPAAAAVAAAAAALVPGSGPAPFPAPGAAPAGGISFHLQIGLSREPV
LLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGLYDKILLFRHDPASDNILQLVKIASD
IQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGL
NYHKRCAFKIPNNCSGVRRRRLSNVSLTGLGTVRTASAEFSTSVPDEPLLSPVSPGFEQK
SPSESFIGREKRSNSQSYIGRPIQLDKLLMSKVKVPHTFVIHSYTRPTVCQFCKKLLKGL
FRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTINGELLSPGAESDVVMEEGSDDNDSERNS
GLMDDMDEAMVQDTEMALAEGQSGGAEMQDPDADQEDSNRTISPSTSNNIPLMRVVQSVK
HTKRRSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILCL
EPAKPSALTPVGATPHCFEITTANVVYYVGENVVNPSSSPPNNSVLPSGIGPDVARMWEV
AIQHALMPVIPKGSSVGSGSNSHKDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQF
GIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPER
VFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLL
ASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIY
VSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTL
SHPWLQDYQTWLDLRELECRIGERYITHESDDSRWEQYAGEQGLQYPAHLISLSASHSDS
PEAEEREMKALSERVSIL
Download sequence
Identical sequences Q62101
ENSMUSP00000002765 ENSMUSP00000002765 NP_032884.2.92730 ENSMUSP00000002765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]