SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002980 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002980
Domain Number 1 Region: 39-379
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.28e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000141
Further Details:      
 
Domain Number 2 Region: 385-495
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.98e-42
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002980   Gene: ENSMUSG00000020664   Transcript: ENSMUST00000002980
Sequence length 510
Comment pep:known chromosome:NCBIM37:12:32016575:32036280:-1 gene:ENSMUSG00000020664 transcript:ENSMUST00000002980
Sequence
MQSWSRVYRSLAKKGHFNRISHGLQGVSSVPLRTYADQPIEADVTVIGSGPGGYVAAIKS
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEIPEVRLNL
EKMMEQKHSAVKALTGGIAHLFKQNKVVHVNGFGKITGKNQVTATKADGSTQVIDTKNIL
VATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGIGIDMEISKNFQRILQRQGFKFKLNTKVTGATKKSDGKIDVSVEAASGGK
AEVITCDVLLVCIGRRPFTQNLGLEELGIELDPKGRIPVNNRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEFKIGK
FPFAANSRAKTNADTDGMVKILGHKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEALEKQTWLQLLENQSTFN
Download sequence
Identical sequences Q3TIE8
10090.ENSMUSP00000002980 ENSMUSP00000002980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]