SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000003313 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000003313
Domain Number 1 Region: 184-538
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-83
Family Protein kinases, catalytic subunit 0.000000381
Further Details:      
 
Domain Number 2 Region: 32-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.62e-44
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000003313   Gene: ENSMUSG00000003228   Transcript: ENSMUST00000003313
Sequence length 590
Comment pep:known chromosome:NCBIM37:19:60965652:61168456:1 gene:ENSMUSG00000003228 transcript:ENSMUST00000003313
Sequence
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYYSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKEIMTKYLTPKSPVFIAQ
VGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLKGDPFHEYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSSKFSEEAKSIC
NMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIETECFKELNVFGPNGTLSPDLNRS
QPPEPPKKGLFHRLFRRQHQSNSKSSPTPKTSCNHRINSNHINSNSTGSS
Download sequence
Identical sequences Q3TST4 Q8VEB1
ENSMUSP00000003313 ENSMUSP00000003313 10090.ENSMUSP00000003313 ENSMUSP00000003313 NP_061357.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]